IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Novel repressor regulates insulin sensitivity through interaction with Foxo1. Novel repressor regulates insulin sensitivity through interaction with Foxo1. EMBO J. (0261-4189) 2012 imex curation Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". jnakae35@sc.itc.keio.ac.jp 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library Only protein-protein interactions mouse-t37i Mouse T37i t37i Mouse T37i - brown adipocyte cell line Derived from a hibernoma (malignant brown fat tumor) of the transgenic mouse founder 37 carrying a hybrid gene composed of the human MR proximal promoter linked to the SV40 large T antigen. ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". jnakae35@sc.itc.keio.ac.jp Accepted 2012-MAY-31 by PPORRAS 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Novel repressor regulates insulin sensitivity through interaction with Foxo1. Novel repressor regulates insulin sensitivity through interaction with Foxo1. EMBO J. (0261-4189) 2012 imex curation Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". jnakae35@sc.itc.keio.ac.jp 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library Only protein-protein interactions in vitro In vitro acetylase assay acetylase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". The authors have confirmed GST-Foxo1 (251-409) is Murine in origin. jnakae35@sc.itc.keio.ac.jp Accepted 2012-MAY-31 by PPORRAS 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Novel repressor regulates insulin sensitivity through interaction with Foxo1. Novel repressor regulates insulin sensitivity through interaction with Foxo1. EMBO J. (0261-4189) 2012 imex curation Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". jnakae35@sc.itc.keio.ac.jp 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library Only protein-protein interactions mouse-white_adipose Mus musculus white_adipose white adipose tissue anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". jnakae35@sc.itc.keio.ac.jp Accepted 2012-MAY-31 by PPORRAS 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Novel repressor regulates insulin sensitivity through interaction with Foxo1. Novel repressor regulates insulin sensitivity through interaction with Foxo1. EMBO J. (0261-4189) 2012 imex curation Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". jnakae35@sc.itc.keio.ac.jp 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". jnakae35@sc.itc.keio.ac.jp Accepted 2012-MAY-31 by PPORRAS mouse 3T3-L1 cDNA library EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Novel repressor regulates insulin sensitivity through interaction with Foxo1. Novel repressor regulates insulin sensitivity through interaction with Foxo1. EMBO J. (0261-4189) 2012 imex curation Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". jnakae35@sc.itc.keio.ac.jp 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library Only protein-protein interactions mouse-brown_adipose Mouse Brown Adipose Tissue brown_adipose Brown Adipose Tissue anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". jnakae35@sc.itc.keio.ac.jp Accepted 2012-MAY-31 by PPORRAS 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Novel repressor regulates insulin sensitivity through interaction with Foxo1. Novel repressor regulates insulin sensitivity through interaction with Foxo1. EMBO J. (0261-4189) 2012 imex curation Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". jnakae35@sc.itc.keio.ac.jp 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". In vitro translated WT Foxo1 has been confirmed to be Murine in origin by the authors. jnakae35@sc.itc.keio.ac.jp Accepted 2012-MAY-31 by PPORRAS 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Novel repressor regulates insulin sensitivity through interaction with Foxo1. Novel repressor regulates insulin sensitivity through interaction with Foxo1. EMBO J. (0261-4189) 2012 imex curation Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". jnakae35@sc.itc.keio.ac.jp 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". Sirt1 has been confirmed by the authors to be Human in origin. jnakae35@sc.itc.keio.ac.jp Accepted 2012-MAY-31 by PPORRAS 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Novel repressor regulates insulin sensitivity through interaction with Foxo1. Novel repressor regulates insulin sensitivity through interaction with Foxo1. EMBO J. (0261-4189) 2012 imex curation Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". jnakae35@sc.itc.keio.ac.jp 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". The authors confirm that:- "The construct used in Figure 3B is FLAG-FCoR, not pCMV5-cMyc-WT FCoR."; also that Sirt-1 was Human in origin. jnakae35@sc.itc.keio.ac.jp Accepted 2012-MAY-31 by PPORRAS 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Novel repressor regulates insulin sensitivity through interaction with Foxo1. Novel repressor regulates insulin sensitivity through interaction with Foxo1. EMBO J. (0261-4189) 2012 imex curation Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". jnakae35@sc.itc.keio.ac.jp 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". Sequence numbering for Delta-256 Foxo1 fragment was located in Nakae et al,. Diabetes, 2008. Myc–tagged Foxo3 expression vector was assembled using full-length mouse cDNA: Nakae et al., J Clin Invest. 2001. jnakae35@sc.itc.keio.ac.jp Accepted 2012-MAY-31 by PPORRAS 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Novel repressor regulates insulin sensitivity through interaction with Foxo1. Novel repressor regulates insulin sensitivity through interaction with Foxo1. EMBO J. (0261-4189) 2012 imex curation Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". jnakae35@sc.itc.keio.ac.jp 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library Only protein-protein interactions mouse-hepatocyte Mouse hepatocyte hepatocyte Liver primary cell A hepatocyte is a cell of the main tissue of the liver. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". Origin of the Hepatocytes was found in Nakae et al., JBC, 1999. jnakae35@sc.itc.keio.ac.jp Accepted 2012-MAY-31 by PPORRAS 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Novel repressor regulates insulin sensitivity through interaction with Foxo1. Novel repressor regulates insulin sensitivity through interaction with Foxo1. EMBO J. (0261-4189) 2012 imex curation Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". jnakae35@sc.itc.keio.ac.jp 20-Jun-2012: Contacted by JYOTI. mouse 3T3-L1 cDNA library Only protein-protein interactions mouse-3t3-f442a Mouse 3T3-F442A Preadipocyte cell line 3t3-f442a 3T3-F442A pre-adipocyte murine cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Nakae J., Cao Y., Hakuno F., Takemori H., Kawano Y., Sekioka R., Abe T., Kiyonari H., Tanaka T., Sakai J., Takahashi S.I., Itoh H. Diabetes - Interactions investigated in the context of Diabetes Figure 4H -In-vitro phosphorylation assay of FCoR, cannot be included as the identity of the enzyme -"catalytic subunit from cAMP-dependent protein kinase" (Promega) cannot be determined - the supplier confirms it is probably a mixture of Bovine PRKACA and PRKACB.. The GenBank reference given for FCOR does give a protein sequence - but I had to create a protein for FCOR as UniProt does not have it- nothing remotely similar found on blasting - Ensembl gene says "No protein product". jnakae35@sc.itc.keio.ac.jp Accepted 2012-MAY-31 by PPORRAS 20-Jun-2012: Contacted by JYOTI. time mouse 3T3-L1 cDNA library EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation fcor_mouse Foxo1-corepressor Fcor Foxo1 CoRepressor protein protein mouse Mus musculus Mouse MGGPTRRHQEEGSAECLGGPSTRAAPGPGLRDFHFTTAGPSKADRLGDAAQIHRERMRPVQCGDGSGERVFLQSPGSIGTLYIRLDLNSQRSTCCCLLNAGTKGMC cdkn1a_mouse_gene Mouse p21 gene gene gene mouse Mus musculus Mouse foxo3_mouse Forkhead box protein O3 Foxo3 Fkhr2 Foxo3a protein protein mouse Mus musculus Mouse MAEAPASPVPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEDDDEDDEDGGGRASSAMVIGGGVSSTLGSGLLLEDSAMLLAPGGQDLGSGPASAAGALSGGTPTQLQPQQPLPQPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQAAPESADDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPILASTELDDVQDDDGPLSPMLYSSSASLSPSVSKPCTVELPRLTDMAGTMNLNDGLAENLMDDLLDNIALPPSQPSPPGGLMQRGSSFPYTAKSSGLGSPTGSFNSTVFGPSSLNSLRQSPMQTIQENRPATFSSVSHYGNQTLQDLLASDSLSHSDVMMTQSDPLMSQASTAVSAQNARRNVMLRNDPMMSFAAQPTQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLSDSSSLGSAKHQQQSPASQSMQTLSDSLSGSSLYSASANLPVMGHDKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG EC218D9BA0C1DAC5 sir1_human NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 SIRT1 SIR2L1 SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein human Homo sapiens Human MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS DIP protein Q96EB6 original sequence version: 140 DIP protein Q96EB6 original sequence version: 71 DIP protein Q96EB6 original sequence version: 125 DIP protein Q96EB6 original sequence version: 115 DIP protein Q96EB6 original sequence version: 63 DIP protein Q96EB6-1 original sequence version: 102 DIP protein Q96EB6 original sequence version: 102 DIP protein Q96EB6 original sequence version: 98 DIP protein Q96EB6 original sequence version: 144 DIP protein Q96EB6 original sequence version: 120 DIP protein Q96EB6-1 original sequence version: 120 DIP protein Q96EB6 original sequence version: 113 DIP protein Q96EB6-1 original sequence version: 117 2D3BEA6D73DA229F foxo1_mouse Forkhead box protein O1 Foxo1 Fkhr Foxo1a Forkhead box protein O1A Forkhead in rhabdomyosarcoma protein protein mouse Mus musculus Mouse MAEAPQVVETDPDFEPLPRQRSCTWPLPRPEFNQSNSTTSSPAPSGGAAANPDAAASLASASAVSTDFMSNLSLLEESEDFARAPGCVAVAAAAAASRGLCGDFQGPEAGCVHPAPPQPPPTGPLSQPPPVPPSAAAAAGPLAGQPRKTSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGPGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSLVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGSMMQQTPCYSFAPPNTSLNSPSPNYSKYTYGQSSMSPLPQMPMQTLQDSKSSYGGLNQYNCAPGLLKELLTSDSPPHNDIMSPVDPGVAQPNSRVLGQNVMMGPNSVMPAYGSQASHNKMMNPSSHTHPGHAQQTASVNGRTLPHVVNTMPHTSAMNRLTPVKTPLQVPLSHPMQMSALGSYSSVSSCNGYGRMGVLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG 3FF58636EA85205F prcg1_mouse_gene PRGC1_MOUSE - Ppargc1a gene gene mouse Mus musculus Mouse ep300_human Histone acetyltransferase p300 Histone butyryltransferase p300 Histone crotonyltransferase p300 Protein propionyltransferase p300 EP300 P300 E1A-associated protein p300 Protein 2-hydroxyisobutyryltransferase p300 Protein lactyltransferas p300 protein protein human Homo sapiens Human MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGDINQLQTSLGMVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQSSPGLGLINSMVKSPMTQAGLTSPNMGMGTSGPNQGPTQSTGMMNSPVNQPAMGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRQNMQYPNPGMGSAGNLLTEPLQQGSPQMGGQTGLRGPQPLKMGMMNNPNPYGSPYTQNPGQQIGASGLGLQIQTKTVLSNNLSPFAMDKKAVPGGGMPNMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKNAGDKRNQQPILTGAPVGLGNPSSLGVGQQSAPNLSTVSQIDPSSIERAYAALGLPYQVNQMPTQPQVQAKNQQNQQPGQSPQGMRPMSNMSASPMGVNGGVGVQTPSLLSDSMLHSAINSQNPMMSENASVPSLGPMPTAAQPSTTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQSGLNQFGQMSMAQPPIVPRQTPPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQNSPSPVPSRTPTPHHTPPSIGAQQPPATTIPAPVPTPPAMPPGPQSQALHPPPRQTPTPPTTQLPQQVQPSLPAAPSADQPQQQPRSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSSTEVNSQAIAEKQPSQEVKMEAKMEVDQPEPADTQPEDISESKVEDCKMESTETEERSTELKTEIKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEIIWPAGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQQPTTPQTPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPPMTPMAPMGMNPPPMTRGPSGHLEPGMGPTGMQQQPPWSQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGISPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNPQPIPGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQQPQQQLQPPMGGMSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQQGAGPGIGPGMANHNQFQQPQGVGYPPQQQQRMQHHMQQMQQGNMGQIGQLPQALGAEAGASLQAYQQRLLQQQMGSPVQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLSTDNSDLNSNLSQSTLDIH DIP protein Q09472 original sequence version: 193 DIP protein Q09472 original sequence version: 186 DIP protein Q09472 original sequence version: 107 DIP protein Q09472 original sequence version: 112 DIP protein Q09472 original sequence version: 181 DIP protein Q09472 original sequence version: 183 DIP protein Q09472 original sequence version: 136 DIP protein Q09472 original sequence version: 146 DIP protein Q09472 original sequence version: 165 DIP protein Q09472 original sequence version: 192 DIP protein Q09472 original sequence version: 200 DIP protein Q09472 original sequence version: 206 DIP protein Q09472 original sequence version: 194 DIP protein Q09472 original sequence version: 171 DIP protein Q09472 original sequence version: 142 DIP protein Q09472 original sequence version: 180 8E869E1F174A6FEB foxo1-fcor 4 16 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role prey prey physical association physical association no figure foxo1-fcor-1 9 16 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1B Lanes 3+7, 4L. hydrogen peroxide The authors conclude from fig 4L that T93D FCoR acetylated Foxo1 the most. fcor-foxo1 9 16 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1B Lanes 1+5 fcor-foxo1-1 3 16 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association 1C foxo1-fcor-3 3 16 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association 1C fcor-foxo1-2 5 16 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association 1C foxo1-fcor-4 5 16 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association 1C fcor-foxo1-3 6 16 unspecified role unspecified role prey prey rabit-reticulocyte Oryctolagus cuniculus reticulocyte reticulocyte Reticulocytes 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 1D fcor-foxo1-4 9 16 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2E, 4M. Forskolin In the presence of forskolin, FCoR did not bind to Foxo1 (Figure 4M, left panel). fcor-foxo3 9 12 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2E foxo3-fcor 9 14 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2E foxo1-fcor-5 9 16 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2E, 4M. In the presence of forskolin, FCoR did not bind to Foxo1 (Figure 4M, left panel). Forskolin fcor-foxo1-6 2 16 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined acetylation acetylation reaction acetylation 3E/F fcor-foxo1-7 2 16 enzyme target enzyme target substrate substrate neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 18 enzyme enzyme neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined acetylation acetylation reaction acetylation 3F foxo1-cdkn1a 11 16 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5F End of clonal expansion. No interaction was observed using cells during clonal expansion. foxo1-cdkn1a-1 11 12 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey promoter_region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5F End of clonal expansion. No interaction was observed using cells during clonal expansion. foxo1-prcg1 1 17 unspecified role unspecified role prey prey s4_proximal_promoter_region_including ire2 (-483 to -890 from tss) binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 7H fcor-foxo1-8 10 16 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig S3 foxo1-sirt1-5 7 16 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey physical association physical association Fig 3B FCoR foxo1-sirt1-6 8 16 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey physical association physical association 3B Co-transfection with FCoR decreased the amount of Sirt1 recovered in Foxo1 immunoprecipitates.