matrixdb Institut de Biologie et de Chimie des Prot\u00c3\u00a9ines, 7, passage du Vercors 69 367 Lyon cedex 07 FRANCE matrixdb@ibcp.fr http://matrixdb.ibcp.fr Glycosaminoglycan backbone is not required for the modulation of hemostasis: effect of different heparin derivatives and non-glycosaminoglycan analogs. Glycosaminoglycan backbone is not required for the modulation of hemostasis: effect of different heparin derivatives and non-glycosaminoglycan analogs. Matrix Biol. (0945-053X) 2012 imex curation Boucas R.I., Jarrouge-Boucas T.R., Lima M.A., Trindade E.S., Moraes F.A., Cavalheiro R.P., Tersariol I.L., Hoppenstead D., Fareed J., Nader H.B. hbnader.bioq@epm.br 11-Oct-2012: Contacted by IntAct-Help. in vitro In vitro enzymatic study enzymatic study weight identificat confirmation by molecular weight weight identificat Boucas R.I., Jarrouge-Boucas T.R., Lima M.A., Trindade E.S., Moraes F.A., Cavalheiro R.P., Tersariol I.L., Hoppenstead D., Fareed J., Nader H.B. hbnader.bioq@epm.br Accepted 2012-SEP-03 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. Matrix Biol. (0945-053X) 2012 imex curation Glycosaminoglycan backbone is not required for the modulation of hemostasis: effect of different heparin derivatives and non-glycosaminoglycan analogs. Glycosaminoglycan backbone is not required for the modulation of hemostasis: effect of different heparin derivatives and non-glycosaminoglycan analogs. Matrix Biol. (0945-053X) 2012 imex curation Boucas R.I., Jarrouge-Boucas T.R., Lima M.A., Trindade E.S., Moraes F.A., Cavalheiro R.P., Tersariol I.L., Hoppenstead D., Fareed J., Nader H.B. hbnader.bioq@epm.br 11-Oct-2012: Contacted by IntAct-Help. in vitro In vitro cleavage cleavage assay cleavage weight by staining molecular weight estimation by staining weight by staining Boucas R.I., Jarrouge-Boucas T.R., Lima M.A., Trindade E.S., Moraes F.A., Cavalheiro R.P., Tersariol I.L., Hoppenstead D., Fareed J., Nader H.B. hbnader.bioq@epm.br Accepted 2012-SEP-03 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. Matrix Biol. (0945-053X) 2012 imex curation hep1_pedhe Heparin lyase I protein protein pedhe Pedobacter heparinus MKKQILYLIVLQQLFLCSAYAQQKKSGNIPYRVNVQADSAKQKAIIDNKWVAVGINKPYALQYDDKLRFNGKPSYRFELKAEDNSLEGYAAGETKGRTELSYSYATTNDFKKFPPSVYQNAQKLKTVYHYGKGICEQGSSRSYTFSVYIPSSFPDNATTIFAQWHGAPSRTLVATPEGEIKTLSIEEFLALYDRMIFKKNIAHDKVEKKDKDGKITYVAGKPNGWKVEQGGYPTLAFGFSKGYFYIKANSDRQWLTDKADRNNANPENSEVMKPYSSEYKTSTIAYKMPFAQFPKDCWITFDVAIDWTKYGKEANTILKPGKLDVMMTYTKNKKPQKAHIVNQQEILIGRNDDDGYYFKFGIYRVGNSTVPVTYNLSGYSETAR B082E0B571DEA699 heparin Heparin small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) hep1-heparin 2 3 enzyme enzyme neutral component neutral component pedhe Pedobacter heparinus UHF 4 enzyme target enzyme target substrate substrate neutral component neutral component pig-gastric mucosa Sus scrofa gastric mucosa gastric_mucosa gastric mucosa cleavage cleavage reaction cleavage 1C hep1-heparin-1 1 3 enzyme enzyme neutral component neutral component pedhe Pedobacter heparinus UHF 4 enzyme target enzyme target substrate substrate neutral component neutral component pig-gastric mucosa Sus scrofa gastric mucosa gastric_mucosa gastric mucosa cleavage cleavage reaction cleavage 1D