MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Identification of a novel protein kinase Cδ-Smac complex that dissociates during paclitaxel-induced cell death. Identification of a novel protein kinase Cδ-Smac complex that dissociates during paclitaxel-induced cell death. FEBS Lett. (0014-5793) 2012 Masoumi KC., Cornmark L., Lønne GK., Hellman U., Larsson C. suggested by lperfetto chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Masoumi KC., Cornmark L., Lønne GK., Hellman U., Larsson C. suggested by lperfetto FEBS Lett. (0014-5793) 2012 Identification of a novel protein kinase Cδ-Smac complex that dissociates during paclitaxel-induced cell death. Identification of a novel protein kinase Cδ-Smac complex that dissociates during paclitaxel-induced cell death. FEBS Lett. (0014-5793) 2012 Masoumi KC., Cornmark L., Lønne GK., Hellman U., Larsson C. suggested by lperfetto human-mcf7 Homo sapiens mammary carcinoma cells mcf7 mammary carcinoma cells anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Masoumi KC., Cornmark L., Lønne GK., Hellman U., Larsson C. suggested by lperfetto FEBS Lett. (0014-5793) 2012 Identification of a novel protein kinase Cδ-Smac complex that dissociates during paclitaxel-induced cell death. Identification of a novel protein kinase Cδ-Smac complex that dissociates during paclitaxel-induced cell death. FEBS Lett. (0014-5793) 2012 Masoumi KC., Cornmark L., Lønne GK., Hellman U., Larsson C. suggested by lperfetto human Homo sapiens Human anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Masoumi KC., Cornmark L., Lønne GK., Hellman U., Larsson C. suggested by lperfetto FEBS Lett. (0014-5793) 2012 dbloh_human Diablo homolog, mitochondrial Second mitochondria-derived activator of caspase Direct IAP-binding protein with low pI DIABLO SMAC protein protein human Homo sapiens Human MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED 70C2AE0DC654D031 kpcd_human Protein kinase C delta type nPKC-delta PRKCD Tyrosine-protein kinase PRKCD PKCD protein protein human Homo sapiens Human MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSFGKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTKDHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIADFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED DIP protein Q05655 original sequence version: 92 DIP protein Q05655 original sequence version: 171 013F4314A2EE331A xiap_human E3 ubiquitin-protein ligase XIAP Inhibitor of apoptosis protein 3 X-linked inhibitor of apoptosis protein IAP-like protein XIAP API3 IAP3 BIRC4 Baculoviral IAP repeat-containing protein 4 RING-type E3 ubiquitin transferase XIAP protein protein human Homo sapiens Human MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDTVRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENYLGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLTPRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSESDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKCFHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTPSLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKDSMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDKCPMCYTVITFKQKIFMS DIP protein P98170 original sequence version: 168 DIP protein P98170 original sequence version: 118 DIP protein P98170 original sequence version: 153 9D394C16D45EB635 prkcd-diablo 3 PKC delta 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level SMAC 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association homomint mint Lysates from cultured cells were immunoprecipitated with antibodies against PKCdelta or Smac (Fig. 1A-D and F). Smac could be detected in PKCdelta precipitates in the cell lines investigated but the interaction was not as evident in some cell lines including PC3, SK-N-BE(2)C, DU-145, nd HeLa cells (Fig. 1A, C and F). Conversely, PKCdelta associated with immunoprecipitated Smac in MDA-MB-231 and MCF-7 cells, although only a weak Smac band was detected for the latter cell type (Fig. 1B and D). Lysates from MDA-MB-231 cells were also immunoprecipitated with antibodies towards PKC aplha, PKC delta, or PKC epsilon Smac was only found in PKCdelta precipitates (Fig. 1E). f1a f1c f1e f1f f2a f2b f2c f3a diablo-prkcd 3 SMAC 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PKC delta 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association homomint mint Lysates from cultured cells were immunoprecipitated with antibodies against PKCdelta or Smac (Fig. 1A-D and F). Smac could be detected in PKCdelta precipitates in the cell lines investigated but the interaction was not as evident in some cell lines including PC3, SK-N-BE(2)C, DU-145, nd HeLa cells (Fig. 1A, C and F). Conversely, PKCdelta associated with immunoprecipitated Smac in MDA-MB-231 and MCF-7 cells, although only a weak Smac band was detected for the latter cell type (Fig. 1B and D). Lysates from MDA-MB-231 cells were also immunoprecipitated with antibodies towards PKC aplha, PKC delta, or PKC epsilon Smac was only found in PKCdelta precipitates (Fig. 1E). f1b f1d f2d f2e prkcd-diablo-1 2 SMAC 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level PKC delta 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f4a homomint mint prkcd-diablo-2 2 SMAC 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell undefined mutation mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:53:21 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'mutation disrupting' 55-59 tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PKC delta 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1g homomint mint xiap-diablo-1 1 XIAP 6 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SMAC 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4c homomint mint