MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Interaction between relaxase MbeA and accessory protein MbeC of the conjugally mobilizable plasmid ColE1. Interaction between relaxase MbeA and accessory protein MbeC of the conjugally mobilizable plasmid ColE1. FEBS Lett. (0014-5793) 2012 imex curation Varsaki A., Lamb HK., Eleftheriadou O., Vandera E., Thompson P., Moncalián G., de la Cruz F., Hawkins AR., Drainas C. avarsaki@gmail.com Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Varsaki A., Lamb HK., Eleftheriadou O., Vandera E., Thompson P., Moncalián G., de la Cruz F., Hawkins AR., Drainas C. avarsaki@gmail.com FEBS Lett. (0014-5793) 2012 Only protein-protein interactions imex curation Interaction between relaxase MbeA and accessory protein MbeC of the conjugally mobilizable plasmid ColE1. Interaction between relaxase MbeA and accessory protein MbeC of the conjugally mobilizable plasmid ColE1. FEBS Lett. (0014-5793) 2012 imex curation Varsaki A., Lamb HK., Eleftheriadou O., Vandera E., Thompson P., Moncalián G., de la Cruz F., Hawkins AR., Drainas C. avarsaki@gmail.com Only protein-protein interactions ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Varsaki A., Lamb HK., Eleftheriadou O., Vandera E., Thompson P., Moncalián G., de la Cruz F., Hawkins AR., Drainas C. avarsaki@gmail.com FEBS Lett. (0014-5793) 2012 Only protein-protein interactions imex curation mbec_ecolx Mobilization protein MbeC mbeC Conjugative accessory protein MbeC protein protein ecolx Escherichia coli MIPMKRERMLTIRVTDDEHARLLERCEGKQLAVWMRRVCLGEPVARSGKLPTLAPPLLRQLAAIGNNLNQTARKVNSGQWSSGDRVQVVAALMAIGDELRRLRLAVREQGARDDS mint 2776BC02394781F7 mbea_ecolx DNA relaxase MbeA mbeA DNA nickase Mobilization protein MbeA protein protein ecolx Escherichia coli MIVKFHARGKGGGSGPVDYLLGRERNREGATVLQGNPEEVRELIDATPFAKKYTSGVLSFAEKELPPGGREKVMASFERVLMPGLEKNQYSILWVEHQDKGRLELNFVIPNMELQTGKRLQPYYDRADRPRIDAWQTLVNHHYGLHDPNAPENRRTLTLPDNLPETKQALAEGVTRGIDALYHAGEIKGRQDVIQALTEAGLEVVRVTRTSISIADPNGGKNIRLKGAFYEQSFADGRGVREKAERESRIYRENAEQRVQEARRICKRGCDIKRDENQRRYSPVHSLDRGIAGKTPGRGERGDDAAQEGRVKAGREYGHDVTGDSLSPVYREWRDALVSWREDTGEPGRNQEAGRDIAETEREDMGRGVCAGREQEIPCPSVREISGGDSLSGERVGTSEGVTQSDRAGNTFAERLRAAATGLYAAAERMGERLRGIAEDVFAYATGQRDAERAGHAVESAGAALERADRTLEPVIQRELEIREERLIQEREHVLSLERERQPEIQERTLDGPSLGW mint 278E41B2D3B2A08A mbea-mbec 1 mbeC 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified mbeA 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction mint t1 f2 the affinity of MbeA for ss-DNA is enhanced by the binding of MbeC to MbeA mbea-mbec-1 2 mbeA 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined mbeC 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3 mint Representative results of the 2HB analysis shown in Figure 3 demonstrate that interactions were only seen with the combination of the N-terminal region of MbeA with the C-terminal region of MbeC