MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A model of dirigent proteins derived from structural and functional similarities with allene oxide cyclase and lipocalins. A model of dirigent proteins derived from structural and functional similarities with allene oxide cyclase and lipocalins. FEBS J. (1742-464X) 2012 Pickel B., Pfannstiel J., Steudle A., Lehmann A., Gerken U., Pleiss J., Schaller A. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Pickel B., Pfannstiel J., Steudle A., Lehmann A., Gerken U., Pleiss J., Schaller A. FEBS J. (1742-464X) 2012 A model of dirigent proteins derived from structural and functional similarities with allene oxide cyclase and lipocalins. A model of dirigent proteins derived from structural and functional similarities with allene oxide cyclase and lipocalins. FEBS J. (1742-464X) 2012 Pickel B., Pfannstiel J., Steudle A., Lehmann A., Gerken U., Pleiss J., Schaller A. in vitro In vitro crosslink cross-linking study crosslink predetermined predetermined participant predetermined Pickel B., Pfannstiel J., Steudle A., Lehmann A., Gerken U., Pleiss J., Schaller A. FEBS J. (1742-464X) 2012 dir6_arath Dirigent protein 6 DIR6 F9D16.160 At4g23690 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAFLVEKQLFKALFSFFLLVLLFSDTVLSFRKTIDQKKPCKHFSFYFHDILYDGDNVANATSAAIVSPPGLGNFKFGKFVIFDGPITMDKNYLSKPVARAQGFYFYDMKMDFNSWFSYTLVFNSTEHKGTLNIMGADLMMEPTRDLSVVGGTGDFFMARGIATFVTDLFQGAKYFRVKMDIKLYECY mint 1C54CA701F18223D dir6 1 AtDIR6 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction f2a mint dir6-1 2 AtDIR6 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction f2b mint