UniProt UniProt http://www.uniprot.org Nesca, a novel neuronal adapter protein, links the molecular motor kinesin with the pre-synaptic membrane protein, syntaxin-1, in hippocampal neurons. Nesca, a novel neuronal adapter protein, links the molecular motor kinesin with the pre-synaptic membrane protein, syntaxin-1, in hippocampal neurons. J. Neurochem. (0022-3042) 2012 imex curation MacDonald J.I., Dietrich A., Gamble S., Hryciw T., Grant R.I., Meakin S.O. Origin of used constructs was confirmed by the authors (e-mail). Regarding human RUSC1/NESCA the publication refers to an 'isoforn 4' which cannot be mapped to an UniProt isoform and which cannot be established following the given reference. The canonical RUSC1/NESCA form in UniProt was mapped instead. Exp. using antibodies against acetylated alpha-tubulin omitted as the antibody is not specific and protein identity cannot be established. Co-localizations in figure 15 have not been put in because they are meant for subcellular localization rather than interaction detection. smeakin@robarts.ca 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions mouse-hippocampus Mouse hippocampal neurons hippocampus Hippocampus [Brain hippocampus] confocal microscopy confocal microscopy immunostaining immunostaining MacDonald J.I., Dietrich A., Gamble S., Hryciw T., Grant R.I., Meakin S.O. Origin of used constructs was confirmed by the authors (e-mail). Regarding human RUSC1/NESCA the publication refers to an 'isoforn 4' which cannot be mapped to an UniProt isoform and which cannot be established following the given reference. The canonical RUSC1/NESCA form in UniProt was mapped instead. Exp. using antibodies against acetylated alpha-tubulin omitted as the antibody is not specific and protein identity cannot be established. Co-localizations in figure 15 have not been put in because they are meant for subcellular localization rather than interaction detection. smeakin@robarts.ca Accepted 2012-AUG-20 by PPORRAS 11-Oct-2012: Contacted by IntAct-Help. J. Neurochem. (0022-3042) 2012 Only protein-protein interactions imex curation Nesca, a novel neuronal adapter protein, links the molecular motor kinesin with the pre-synaptic membrane protein, syntaxin-1, in hippocampal neurons. Nesca, a novel neuronal adapter protein, links the molecular motor kinesin with the pre-synaptic membrane protein, syntaxin-1, in hippocampal neurons. J. Neurochem. (0022-3042) 2012 imex curation MacDonald J.I., Dietrich A., Gamble S., Hryciw T., Grant R.I., Meakin S.O. Origin of used constructs was confirmed by the authors (e-mail). Regarding human RUSC1/NESCA the publication refers to an 'isoforn 4' which cannot be mapped to an UniProt isoform and which cannot be established following the given reference. The canonical RUSC1/NESCA form in UniProt was mapped instead. Exp. using antibodies against acetylated alpha-tubulin omitted as the antibody is not specific and protein identity cannot be established. Co-localizations in figure 15 have not been put in because they are meant for subcellular localization rather than interaction detection. smeakin@robarts.ca 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro cosedimentation cosedimentation western blot western blot Immuno blot Immuno blot MacDonald J.I., Dietrich A., Gamble S., Hryciw T., Grant R.I., Meakin S.O. Origin of used constructs was confirmed by the authors (e-mail). Regarding human RUSC1/NESCA the publication refers to an 'isoforn 4' which cannot be mapped to an UniProt isoform and which cannot be established following the given reference. The canonical RUSC1/NESCA form in UniProt was mapped instead. Exp. using antibodies against acetylated alpha-tubulin omitted as the antibody is not specific and protein identity cannot be established. Co-localizations in figure 15 have not been put in because they are meant for subcellular localization rather than interaction detection. smeakin@robarts.ca Accepted 2012-AUG-20 by PPORRAS 11-Oct-2012: Contacted by IntAct-Help. J. Neurochem. (0022-3042) 2012 Only protein-protein interactions imex curation Nesca, a novel neuronal adapter protein, links the molecular motor kinesin with the pre-synaptic membrane protein, syntaxin-1, in hippocampal neurons. Nesca, a novel neuronal adapter protein, links the molecular motor kinesin with the pre-synaptic membrane protein, syntaxin-1, in hippocampal neurons. J. Neurochem. (0022-3042) 2012 imex curation MacDonald J.I., Dietrich A., Gamble S., Hryciw T., Grant R.I., Meakin S.O. Origin of used constructs was confirmed by the authors (e-mail). Regarding human RUSC1/NESCA the publication refers to an 'isoforn 4' which cannot be mapped to an UniProt isoform and which cannot be established following the given reference. The canonical RUSC1/NESCA form in UniProt was mapped instead. Exp. using antibodies against acetylated alpha-tubulin omitted as the antibody is not specific and protein identity cannot be established. Co-localizations in figure 15 have not been put in because they are meant for subcellular localization rather than interaction detection. smeakin@robarts.ca 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot MacDonald J.I., Dietrich A., Gamble S., Hryciw T., Grant R.I., Meakin S.O. Origin of used constructs was confirmed by the authors (e-mail). Regarding human RUSC1/NESCA the publication refers to an 'isoforn 4' which cannot be mapped to an UniProt isoform and which cannot be established following the given reference. The canonical RUSC1/NESCA form in UniProt was mapped instead. Exp. using antibodies against acetylated alpha-tubulin omitted as the antibody is not specific and protein identity cannot be established. Co-localizations in figure 15 have not been put in because they are meant for subcellular localization rather than interaction detection. smeakin@robarts.ca Accepted 2012-AUG-20 by PPORRAS 11-Oct-2012: Contacted by IntAct-Help. J. Neurochem. (0022-3042) 2012 Only protein-protein interactions imex curation Nesca, a novel neuronal adapter protein, links the molecular motor kinesin with the pre-synaptic membrane protein, syntaxin-1, in hippocampal neurons. Nesca, a novel neuronal adapter protein, links the molecular motor kinesin with the pre-synaptic membrane protein, syntaxin-1, in hippocampal neurons. J. Neurochem. (0022-3042) 2012 imex curation MacDonald J.I., Dietrich A., Gamble S., Hryciw T., Grant R.I., Meakin S.O. Origin of used constructs was confirmed by the authors (e-mail). Regarding human RUSC1/NESCA the publication refers to an 'isoforn 4' which cannot be mapped to an UniProt isoform and which cannot be established following the given reference. The canonical RUSC1/NESCA form in UniProt was mapped instead. Exp. using antibodies against acetylated alpha-tubulin omitted as the antibody is not specific and protein identity cannot be established. Co-localizations in figure 15 have not been put in because they are meant for subcellular localization rather than interaction detection. smeakin@robarts.ca 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot MacDonald J.I., Dietrich A., Gamble S., Hryciw T., Grant R.I., Meakin S.O. Origin of used constructs was confirmed by the authors (e-mail). Regarding human RUSC1/NESCA the publication refers to an 'isoforn 4' which cannot be mapped to an UniProt isoform and which cannot be established following the given reference. The canonical RUSC1/NESCA form in UniProt was mapped instead. Exp. using antibodies against acetylated alpha-tubulin omitted as the antibody is not specific and protein identity cannot be established. Co-localizations in figure 15 have not been put in because they are meant for subcellular localization rather than interaction detection. smeakin@robarts.ca Accepted 2012-AUG-20 by PPORRAS 11-Oct-2012: Contacted by IntAct-Help. J. Neurochem. (0022-3042) 2012 Only protein-protein interactions imex curation Nesca, a novel neuronal adapter protein, links the molecular motor kinesin with the pre-synaptic membrane protein, syntaxin-1, in hippocampal neurons. Nesca, a novel neuronal adapter protein, links the molecular motor kinesin with the pre-synaptic membrane protein, syntaxin-1, in hippocampal neurons. J. Neurochem. (0022-3042) 2012 imex curation MacDonald J.I., Dietrich A., Gamble S., Hryciw T., Grant R.I., Meakin S.O. Origin of used constructs was confirmed by the authors (e-mail). Regarding human RUSC1/NESCA the publication refers to an 'isoforn 4' which cannot be mapped to an UniProt isoform and which cannot be established following the given reference. The canonical RUSC1/NESCA form in UniProt was mapped instead. Exp. using antibodies against acetylated alpha-tubulin omitted as the antibody is not specific and protein identity cannot be established. Co-localizations in figure 15 have not been put in because they are meant for subcellular localization rather than interaction detection. smeakin@robarts.ca 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western MacDonald J.I., Dietrich A., Gamble S., Hryciw T., Grant R.I., Meakin S.O. Origin of used constructs was confirmed by the authors (e-mail). Regarding human RUSC1/NESCA the publication refers to an 'isoforn 4' which cannot be mapped to an UniProt isoform and which cannot be established following the given reference. The canonical RUSC1/NESCA form in UniProt was mapped instead. Exp. using antibodies against acetylated alpha-tubulin omitted as the antibody is not specific and protein identity cannot be established. Co-localizations in figure 15 have not been put in because they are meant for subcellular localization rather than interaction detection. smeakin@robarts.ca Accepted 2012-AUG-20 by PPORRAS 11-Oct-2012: Contacted by IntAct-Help. J. Neurochem. (0022-3042) 2012 Only protein-protein interactions imex curation rusc1_mouse AP-4 complex accessory subunit RUSC1 Rusc1 Nesca New molecule containing SH3 at the carboxy-terminus RUN and SH3 domain-containing protein 1 protein protein mouse Mus musculus Mouse MLSPQRALLCNLNHIHLQHVSLGLHLSRRPELREGPLSTPPPPGDTGGKESRGPCSGTLVDANSNSPAVPCRCCQEHGSSIENQQDPSQEEEAVSPSDPGCSSSLSSCSDLSPDESPVSVYSRDLPGNEDANPQPSTLELGSPLAPAGPSTCSPDSFCCSPDSCSGISSPPGPDLDSNCNALTTCQDLPSPGLEEEEDSGEQDLATSELSETEDGRIDAGKAEPSWKINPIWKIDTEKTEAGWKTIEDSDSGRKTDENTNSSLKTESGKLASCLNTNSGSKIDAGKTDGGWRGDVSQEPVPHRTITSFHELAQKRKRGPGLPLVPQAKKDRSDWLIVFSPDTELPPTGSLGGSLAPPREVTTFKELRSRSRAQPPPVPPRDPPAGWALVPPRPPPPPVPPRRKKNRLGLQPIAEGLSEEGRAASPRAGEEASASQEPEEPRAHAVVRSSWSFAGVPGAQRLWMAEAQSGTGQLQEQKKGLLIAVSASVDKIISHFGAARNLVQKAQLGDSRLSPDVGHLVLTTLCPALHALVADGLKPFRKDLITGQRRSSPWSVVEASVKPGSCTHSMGSLYSQVSRLAPLSSSRSRFHAFILGLLNTKQLELWFSSLQEDAGLLSLLYLPTGFFSLARGSCPSLATELLLLLQPLSVLTFHLDLLFEHHHHLPVGLQQAPAPSCPPPALQQTMQAVLHWGERLAQSLRGTSGESTTDSSTPSARPPAGSWWDQLTQASRVYASGGTEGFPLLRWGPRRHGTTAEAAQEAPPPTEQTTPGRSVWLGRLFGVPGCPSETESGAFKSRRPSSWLPPTVSVLALVKRGTPPETPPEALVSSPGSVVQADRAVRALCDHTAAGPDQLSFQRGELLRVIATVDEDWLRCGRDGVEGLVPVGYTSLVL B7CB4102A3CFAAB2 klc1_human Kinesin light chain 1 KLC1 KLC KNS2 protein protein human Homo sapiens Human MYDNMSTMVYIKEDKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLFPNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPIWMHAEEREECKGKQKDGTSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAAMRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGEEVSMSVEWNGGVSGRASFCGKRQQQQWPGRRHR DIP protein Q07866 original sequence version: 146 A66E3915C57C2764 kinh_human Kinesin-1 heavy chain KIF5B KNS KNS1 Ubiquitous kinesin heavy chain Conventional kinesin heavy chain protein protein human Homo sapiens Human MADLAECNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVMDTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVICCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEKEKEKNKILRNTIQWLENELNRWRNGETVPIDEQFDKEKANLEAFTVDKDITLTNDKPATAIGVIGNFTDAERRKCEEEIAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSEVKTMVKRCKQLESTQTESNKKMEENEKELAACQLRISQHEAKIKSLTEYLQNVEQKKRQLEESVDALSEELVQLRAQEKVHEMEKEHLNKVQTANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKAKLITDLQDQNQKMMLEQERLRVEHEKLKATDQEKSRKLHELTVMQDRREQARQDLKGLEETVAKELQTLHNLRKLFVQDLATRVKKSAEIDSDDTGGSAAQKQKISFLENNLEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVDRIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPTHPSAIRGGGAFVQNSQPVAVRGGGGKQV DIP protein P33176 original sequence version: 148 DIP protein P33176 original sequence version: 65 DIP protein P33176 original sequence version: 133 DIP protein P33176 original sequence version: 102 DIP protein P33176 original sequence version: 152 A1FE5760C3250C8B stx1a_rat Syntaxin-1A Synaptotagmin-associated 35 kDa protein Neuron-specific antigen HPC-1 Stx1a Sap protein protein rat Rattus norvegicus (Rat) Rat MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG DIP protein P32851 original sequence version: 74 DIP protein P32851 original sequence version: 78 DIP protein P32851 original sequence version: 142 DIP protein P32851 original sequence version: 138 DIP protein P32851 original sequence version: 89 DIP protein P32851 original sequence version: 115 DIP protein P32851 original sequence version: 134 DIP protein P32851 original sequence version: 121 DIP protein P32851 original sequence version: 123 DIP protein P32851 original sequence version: 150 DIP protein P32851 original sequence version: 156 DIP protein P32851 original sequence version: 163 DIP protein P32851 original sequence version: 126 DIP protein P32851 original sequence version: 124 DIP protein P32851 original sequence version: 158 8F929F489E323CAA mtap2_mouse Microtubule-associated protein 2 Map2 Mtap2 protein protein mouse Mus musculus Mouse MADERKDEGKAPHWTSASLTEAAAHPHSPEMKDQGGAGEGLSRNANGFPYREEEEGAFGEHRSQGTYSDTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQPAALPLAAEETANLPPSPPPSPASEQTATVEEDLLTASKMEFPEQEKFPSSFAEPLDKGEMEFKMPSKPGEDFEHAALVPDTSKTPQDKKDLQGMEGEKLPPVPFAQTFGTNLEDRKQSTEPSIVMPSIGLSAEPPAPKEPKDWFIEMPTESKKDEWGLAAPISPGPLTPMREKDVLEDIPRWEGKQFDSPMPSPFHGGSFTLPLDTMKNERVSEGPRPFAPVFFQSDDKVSLQDPSALATSKESSKDEEPLKDKADKVADVSISEVTTLLGNVHSPVVEGYVGENISGEVKVTTDQEKKETSAPSVQEPTLTETEPQTKLDEKSTVSIEEAVAKKEESFKLRDDKTGVIQTSTEQSFSKEDQKGQEHTIDELKQDSFPISLEQAVTDAAMTSKTLGKVTSEPEAVSERREIQGLFEEKTADKNKLEGAGSATIAEVEMPFYEDKSGMSKYFETSALKEDMTRSTELGSDYYELSDSRGSAQESLDTISPKNQHDEKELQAKASQPSPPAQEAGYSTLAQSYTPDHPSELPEEPSSPQERMFTIDPKVYGEKRDLHSKNKDDLTLSRSLGLGGRSAIEQRSMSINLPMSCLDSIALGFNFGRGHDLSPLASDILTNTSGSMDEGDDYLPPTTPAVEKMPCFPIESKEEEDKAEQAKVTGGQTIQVETSSESPFPAKEYYKNGTVMAPDLPEMLDLAGTRSRLASVSADAEVARRKSVPSEAMLAESSTSLPPVADESPVTVKPDSQLEDMGYCVFNKYTVPLPSPVQDSENLSGESGSFYEGTDDKVRRDLATDLSLIEVKLAAAGRVKDEFTAEKEASPPTSADKSRLSREFDHDRKANDKLDTVLEKSEEHIDSKEHAKESEEMGGKVELFGLGITYDQASTKELITTKDTSPEKTEKGLSSVPEVAEVEPTTKADQGLDFAATKAEPSQLDIKVSDFGQMASGMNVDAGKAIELKFEVAQELTLSSEAPQEADSFMGVESGHIKEGGKVNETEVKEKVTKPDLVHQEAVDKEESYESSGEHESLTMESLKPDEGKKETSPETSLIQDEVALKLSVEIPCPPPVSEADLSTDEKGEVQMEFIQLPKEESTETPDIPAIPSDVTQPQPEAIVSEPAEVPSEEEEIEAGGEYDKLLFRSDTLQISDLLVSESREEFVETCPGELKGVVESVVTIEDDFITVVQTTTDEGESGSHSVRFAAPAQPEEERRPRPHDEELEIEMAAEAQAEPKDGSPDAPATPEKEEVAFSEYKTETYDDYKDETTIDDSIMDADSLWVDTQDDDRSILTEQLETIPKEERAEKDARRPSLEKHRKEKPFKTGRGRISTPERKVAKKEPSTVSRDEVRRKKAVYKKAELAKKSEVQAHSPSRKLILKPAIKYTRPTHLSCVKRKTTAASGDLAQAPGAFKQAKDKVTDGISKSPEKRSSLPRPSSILPPRRGVSGDREENSFSLNSSISSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPGTPKSGILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPSRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL E8FA7621C45D5A0D rusc1_human AP-4 complex accessory subunit RUSC1 RUSC1 NESCA New molecule containing SH3 at the carboxy-terminus RUN and SH3 domain-containing protein 1 protein protein human Homo sapiens Human MLSPQRALLCNLNHIHLQHVSLGLHLSRRPELQEGPLSTPPPPGDTGGKESRGPCSGTLVDANSNSPAVPCRCCQEHGPGLENRQDPSQEEEGAASPSDPGCSSSLSSCSDLSPDESPVSVYLRDLPGDEDAHPQPSIIPLEQGSPLASAGPGTCSPDSFCCSPDSCSGASSSPDPGLDSNCNALTTCQDVPSPGLEEEDERAEQDLPTSELLEADDGKIDAGKTEPSWKINPIWKIDTEKTKAEWKTTENNNTGWKNNGNVNSSWKSEPEKFDSGWKTNTRITDSGSKTDAGKIDGGWRSDVSEEPVPHRTITSFHELAQKRKRGPGLPLVPQAKKDRSDWLIVFSPDTELPPSGSPGGSSAPPREVTTFKELRSRSRAPAPPVPPRDPPVGWALVPPRPPPPPVPPRRKKNRPGLQPIAEGQSEEGRAVSPAAGEEAPAAKEPGAQAGLEVRSSWSFAGVPGAQRLWMAEAQSGTGQLQEQKKGLLIAVSVSVDKIISHFGAARNLVQKAQLGDSRLSPDVGHLVLTTLCPALHALVADGLKPFRKDLITGQRRSSPWSVVEASVKPGSSTRSLGTLYSQVSRLAPLSSSRSRFHAFILGLLNTKQLELWFSSLQEDAGLLSLLYLPTGFFSLARGGCPSLSTELLLLLQPLSVLTFHLDLLFEHHHHLPLGPPQAPAPPGPPPALQQTMQAMLHFGGRLAQSLRGTSKEAASDPSDSPNLPTPGSWWEQLTQASRVYASGGTEGFPLSRWAPGRHGTAAEEGAQERPLPTDEMAPGRGLWLGRLFGVPGGPAENENGALKSRRPSSWLPPTVSVLALVKRGAPPEMPSPQELEASAPRMVQTHRAVRALCDHTAARPDQLSFRRGEVLRVITTVDEDWLRCGRDGMEGLVPVGYTSLVL 41DB65236E766A82 klc1_mouse Kinesin light chain 1 Klc1 Kns2 protein protein mouse Mus musculus Mouse MYDNMSTMVYIKEEKLENVTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDDESNLVEEKSSMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQNVRAQVRRLCQENQWLRDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDSDSSKEPLDDLFPNDEDEPGQGIQHSDSSAAAARQGYEIPARLRTLHNLVIQYASQGRYEVAVPSCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGRDHPAVAATLNNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEYYYQRALGIYQTKLGPDRTPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEAEFGSVDDENKPIWMHAEEREECKGKQKDGSAFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKFEAAETLEEAAMRSRKQGLDNVHKQRVAEVLNDPESMEKRRSRESLNMDVVKYESGPDGGEEA DIP protein O88447 original sequence version: 83 550F23AB36049C03 stx1a_mouse Syntaxin-1A Stx1a Neuron-specific antigen HPC-1 protein protein mouse Mus musculus Mouse MKDRTQELRTAKDSDDDDDVTVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEKTKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSDYRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIIIASTIGGIFG DIP protein O35526 original sequence version: 122 DIP protein O35526 original sequence version: 124 DIP protein O35526 original sequence version: 139 8F8255F2EEF886CA tbb3_mouse Tubulin beta-3 chain Tubb3 protein protein mouse Mus musculus Mouse MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEGEMYEDDDEESEAQGPK DIP protein Q9ERD7 original sequence version: 82 4B9D9B7DBA102949 actb_rabit Actin, cytoplasmic 1 ACTB Beta-actin protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEERPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF CB1D01AFBF036B99 actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF DIP protein P60709 original sequence version: null DIP protein P60709 original sequence version: 63 DIP protein P60709 original sequence version: 128 DIP protein P60709 original sequence version: 129 DIP protein P60709 original sequence version: 58 DIP protein P60709 original sequence version: 66 DIP protein P60709 original sequence version: 88 DIP protein P60709 original sequence version: 89 DIP protein P60709 original sequence version: 86 DIP protein P60709 original sequence version: 138 DIP protein P60709 original sequence version: 112 6AFD05CA94E360E2 kinh_mouse Kinesin-1 heavy chain Ubiquitous kinesin heavy chain Conventional kinesin heavy chain Kif5b Khcs Kns1 protein protein mouse Mus musculus Mouse MADPAECNIKVMCRFRPLNESEVNRGDKYVAKFQGEDTVMIASKPYAFDRVFQSSTSQEQVYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVMDTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSKTGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVICCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEKEKEKNKTLRNTIQWLENELNRWRNGETVPIDEQFDKEKANLEAFTADKDIAITSDKPAAAVGMAGSFTDAERRKCEEELAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAENDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKLKEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSEVKTMVKRCKQLESTQTESNKKMEENEKELAACQLRISQHEAKIKSLTEYLQNVEQKKRQLEESVDSLGEELVQLRAQEKVHEMEKEHLNKVQTANEVKQAVEQQIQSHRETHQKQISSLRDEVEAKEKLITDLQDQNQKMVLEQERLRVEHERLKATDQEKSRKLHELTVMQDRREQARQDLKGLEETVAKELQTLHNLRKLFVQDLATRVKKSAEVDSDDTGGSAAQKQKISFLENNLEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVDRIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPTHPGTVRGGGSFVQNNQPVGLRGGGGKQS DIP protein Q61768 original sequence version: 116 C3D3461A0C314901 actb-rusc1 5 11 unspecified role unspecified role prey prey c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 16 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 7a actb-rusc1-2 2 11 unspecified role unspecified role neutral component neutral component c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 15 unspecified role unspecified role neutral component neutral component purified purified The authors have used purified rabbit non-muscle actin from Sigma, but it could not be found it in the Sigma catalog, hence the "expressed_in" field was left empty. colocalization colocalization 7b rusc1-actb-1 4 6 unspecified role unspecified role bait bait n-terminus protein a tag protein a tag protein A protein A n-term range n-terminal range n-term range n-term range n-terminal range n-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 15 unspecified role unspecified role prey prey purified purified ecoli Escherichia coli (strain K12) physical association physical association 7c rusc1-tubb3-1 3 6 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association 8b map2-rusc1-1 2 11 unspecified role unspecified role neutral component neutral component human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 14 unspecified role unspecified role neutral component neutral component mouse-brain-cortex Mus musculus brain cortex brain_cortex Brain cortex [Cerebral cortex; Cerebrum cortex; Cortex; Pallium] 10 unspecified role unspecified role neutral component neutral component mouse-brain-cortex Mus musculus brain cortex brain_cortex Brain cortex [Cerebral cortex; Cerebrum cortex; Cortex; Pallium] colocalization colocalization 8c Acetylated alpha-tubulin is also cosedimented. rusc1-tubb3-2 1 6 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component colocalization colocalization 10b kif5b-rusc1 3 6 unspecified role unspecified role prey prey 17 unspecified role unspecified role bait bait physical association physical association 12a kif5b-klc1 3 12 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 12a kif5b-rusc1-2 5 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role prey prey c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. physical association physical association 12b kif5b-klc1-1 5 11 unspecified role unspecified role prey prey c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 12b kif5b-klc1-2 1 12 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization 12c stx1a-rusc1 3 6 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association 14a stx1a-rusc1-1 5 11 unspecified role unspecified role prey prey c-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 9 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association 14b rusc1-stx1a 1 13 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization 14c