MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Claudin-14 regulates renal Ca⁺⁺ transport in response to CaSR signalling via a novel microRNA pathway. Claudin-14 regulates renal Ca⁺⁺ transport in response to CaSR signalling via a novel microRNA pathway. EMBO J. (0261-4189) 2012 imex curation Gong Y., Renigunta V., Himmerkus N., Zhang J., Renigunta A., Bleich M., Hou J. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Gong Y., Renigunta V., Himmerkus N., Zhang J., Renigunta A., Bleich M., Hou J. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Claudin-14 regulates renal Ca⁺⁺ transport in response to CaSR signalling via a novel microRNA pathway. Claudin-14 regulates renal Ca⁺⁺ transport in response to CaSR signalling via a novel microRNA pathway. EMBO J. (0261-4189) 2012 imex curation Gong Y., Renigunta V., Himmerkus N., Zhang J., Renigunta A., Bleich M., Hou J. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined Gong Y., Renigunta V., Himmerkus N., Zhang J., Renigunta A., Bleich M., Hou J. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation cld14_mouse Claudin-14 Cldn14 protein protein mouse Mus musculus Mouse MASTAVQLLGFLLSFLGMVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQCQIYRSLLALPRDLQAARALMVISCLLSGMACACAVVGMKCTRCAKGTPAKTTFAVLGGALFLLAGLLCMVAVSWTTNDVVQNFYNPLLPSGMKFEIGQALYLGFISSSLSLIGGTLLCLSCQDEAPYRPYPPQSRAGATTTATAPAYRPPAAYKDNRAPSVTSAAHSGYRLNDYV mint 24DE6AEADA56BB61 cld16_human Claudin-16 CLDN16 PCLN1 Paracellin-1 protein protein human Homo sapiens Human MTSRTPLLVTACLYYSYCNSRHLQQGVRKSKRPVFSHCQVPETQKTDTRHLSGARAGVCPCCHPDGLLATMRDLLQYIACFFAFFSAGFLIVATWTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTRALMITADILAGFGFLTLLLGLDCVKFLPDEPYIKVRICFVAGATLLIAGTPGIIGSVWYAVDVYVERSTLVLHNIFLGIQYKFGWSCWLGMAGSLGCFLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETAKMYAVDTRV DIP protein Q9Y5I7 original sequence version: 88 mint homomint 2A85A19A39727329 cld19_human Claudin-19 CLDN19 protein protein human Homo sapiens Human MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAIAGGALFILAGLCTLTAVSWYATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREPVVKLPASAKGPLGV 60E1A21902415219 cldn14-cldn16 1 CLDN16 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CLDN14 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f3a f3b cldn14-cldn14 1 CLDN14 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CLDN14 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association mint f3a f3b cldn19-cldn14 2 CLDN14 3 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell CLDN19 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association f3e mint In triply transfected cells expressing three claudins at the molecular ratio of 1:1:1, anti-CLDN19 antibody now precipitated CLDN14 with similar affinity to anti-CLDN16 antibody (Figure 3E), suggesting (i) CLDN19 acted through CLDN16 to interact with CLDN14; (ii) CLDN14 integrated into the CLDN16 CLDN19 complex instead of forming an independent CLDN14 CLDN16 complex. Anti-CLDN14 antibody precipitated the same amount of CLDN16 as anti-CLDN19 antibody (Figure 3E) cldn19-cldn16 2 CLDN16 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell CLDN19 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association f3e homomint mint In triply transfected cells expressing three claudins at the molecular ratio of 1:1:1, anti-CLDN19 antibody now precipitated CLDN14 with similar affinity to anti-CLDN16 antibody (Figure 3E), suggesting (i) CLDN19 acted through CLDN16 to interact with CLDN14; (ii) CLDN14 integrated into the CLDN16 CLDN19 complex instead of forming an independent CLDN14 CLDN16 complex. Anti-CLDN14 antibody precipitated the same amount of CLDN16 as anti-CLDN19 antibody (Figure 3E) cldn14-cldn16-1 2 CLDN16 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell CLDN14 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association mint f3e f3c cldn16-cldn14 2 CLDN14 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell CLDN16 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell physical association physical association mint f3e f3c