MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Arginine methylation controls growth regulation by E2F-1. Arginine methylation controls growth regulation by E2F-1. EMBO J. (0261-4189) 2012 imex curation Cho EC., Zheng S., Munro S., Liu G., Carr SM., Moehlenbrink J., Lu YC., Stimson L., Khan O., Konietzny R., McGouran J., Coutts AS., Kessler B., Kerr DJ., Thangue NB. Only protein-protein interactions in vitro In vitro pull down pull down predetermined predetermined participant predetermined Cho EC., Zheng S., Munro S., Liu G., Carr SM., Moehlenbrink J., Lu YC., Stimson L., Khan O., Konietzny R., McGouran J., Coutts AS., Kessler B., Kerr DJ., Thangue NB. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Arginine methylation controls growth regulation by E2F-1. Arginine methylation controls growth regulation by E2F-1. EMBO J. (0261-4189) 2012 imex curation Cho EC., Zheng S., Munro S., Liu G., Carr SM., Moehlenbrink J., Lu YC., Stimson L., Khan O., Konietzny R., McGouran J., Coutts AS., Kessler B., Kerr DJ., Thangue NB. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cho EC., Zheng S., Munro S., Liu G., Carr SM., Moehlenbrink J., Lu YC., Stimson L., Khan O., Konietzny R., McGouran J., Coutts AS., Kessler B., Kerr DJ., Thangue NB. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Arginine methylation controls growth regulation by E2F-1. Arginine methylation controls growth regulation by E2F-1. EMBO J. (0261-4189) 2012 imex curation Cho EC., Zheng S., Munro S., Liu G., Carr SM., Moehlenbrink J., Lu YC., Stimson L., Khan O., Konietzny R., McGouran J., Coutts AS., Kessler B., Kerr DJ., Thangue NB. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Cho EC., Zheng S., Munro S., Liu G., Carr SM., Moehlenbrink J., Lu YC., Stimson L., Khan O., Konietzny R., McGouran J., Coutts AS., Kessler B., Kerr DJ., Thangue NB. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation e2f1_human Transcription factor E2F1 Retinoblastoma-associated protein 1 Retinoblastoma-binding protein 3 PBR3 E2F1 RBBP3 pRB-binding protein E2F-1 protein protein human Homo sapiens Human MALAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISAAQDASAPPAPTGPAAPAAGPCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTTVGVGGRLEGLTQDLRQLQESEQQLDHLMNICTTQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSSENFQISLKSKQGPIDVFLCPEETVGGISPGKTPSQEVTSEEENRATDSATIVSPPPSSPPSSLTTDPSQSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEHVREDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF DIP protein Q01094 original sequence version: 173 DIP protein Q01094 original sequence version: 168 DIP protein Q01094 original sequence version: 149 DIP protein Q01094 original sequence version: 130 DIP protein Q01094 original sequence version: 125 DIP protein Q01094 original sequence version: 153 DIP protein Q01094 original sequence version: 180 003B3F654F0C60DF anm5_human Protein arginine N-methyltransferase 5 PRMT5 IBP72 JBP1 HRMT1L5 Shk1 kinase-binding protein 1 homolog Jak-binding protein 1 72 kDa ICln-binding protein SKB1 Histone-arginine N-methyltransferase PRMT5 protein protein human Homo sapiens Human MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL DIP protein O14744 original sequence version: 86 DIP protein O14744 original sequence version: 104 DIP protein O14744-1 original sequence version: 148 DIP protein O14744-1 original sequence version: 114 DIP protein O14744 original sequence version: 146 522E255B384F25E7 tfdp1_human Transcription factor Dp-1 E2F dimerization partner 1 DRTF1-polypeptide 1 TFDP1 DP1 protein protein human Homo sapiens Human MAKDAGLIEANGELKVFIDQNLSPGKGVVSLVAVHPSTVNPLGKQLLPKTFGQSNVNIAQQVVIGTPQRPAASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEVERQRRLERIKQKQSQLQELILQQIAFKNLVQRNRHAEQQASRPPPPNSVIHLPFIIVNTSKKTVIDCSISNDKFEYLFNFDNTFEIHDDIEVLKRMGMACGLESGSCSAEDLKMARSLVPKALEPYVTEMAQGTVGGVFITTAGSTSNGTRFSASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDEDD DIP protein Q14186 original sequence version: 128 3FEEFE1E49FD9ED0 e2f1-prmt5 2 E2F-1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PRMT5 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1c homomint mint prmt5-e2f1 2 PRMT5 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level E2F-1 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1c homomint mint e2f1-prmt5-1 1 E2F-1 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PRMT5 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level DP-1 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f1d homomint mint e2f1-prmt5-2 1 PRMT5 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level E2F-1 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Q01094:p.Arg113Lys mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R K Tue Jul 12 10:54:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:20:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg113lys' Tue Jun 30 18:47:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg113Lys' Q01094:p.Arg109Lys mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R K Tue Jul 12 10:16:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:03:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg109lys' Tue Jun 30 19:54:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg109Lys' Q01094:p.Arg111Lys mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R K Tue Jul 12 10:56:32 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 18:16:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg111lys' Tue Jun 30 18:04:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg111Lys' gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f1d homomint mint e2f1-prmt5-3 1 PRMT5 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level E2F-1 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified Q01094:p.Arg111Lys mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R K Tue Jul 12 10:56:18 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 16:41:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg111lys' Tue Jun 30 20:20:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg111Lys' gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q01094:p.Arg113Lys mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R K Tue Jul 12 10:19:10 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:53:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg113lys' Tue Jun 30 16:38:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg113Lys' physical association physical association f1d homomint mint e2f1-prmt5-4 3 E2F-1 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q01094:p.Arg113Lys mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R K Tue Jul 12 10:21:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:20:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg113lys' Tue Jun 30 19:44:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg113Lys' Q01094:p.Arg111Lys mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R K Tue Jul 12 10:21:51 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 15:12:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg111lys' Tue Jun 30 17:40:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg111Lys' PRMT5 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1e homomint mint e2f1-prmt5-5 3 E2F-1 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell Q01094:p.Arg113Lys mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R K Tue Jul 12 10:24:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 17:38:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg113lys' Tue Jun 30 17:55:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg113Lys' ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q01094:p.Arg111Lys mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R K Tue Jul 12 10:24:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 19:05:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg111lys' Tue Jun 30 20:21:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg111Lys' Q01094:p.Arg109Lys mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R K Tue Jul 12 10:24:31 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'mutation disrupting' Wed May 02 20:32:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg109lys' Tue Jun 30 16:43:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg109Lys' PRMT5 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f1e homomint mint e2f1-prmt5-6 3 DP-1 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PRMT5 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level E2F-1 4 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association f1e homomint mint