UniProt UniProt http://www.uniprot.org The ubiquitin E3 ligase LOSS OF GDU2 is required for GLUTAMINE DUMPER1-induced amino acid secretion in Arabidopsis. The ubiquitin E3 ligase LOSS OF GDU2 is required for GLUTAMINE DUMPER1-induced amino acid secretion in Arabidopsis. Plant Physiol. (0032-0889) 2012 imex curation Pratelli R., Guerra D.D., Yu S., Wogulis M., Kraft E., Frommer W.B., Callis J., Pilot G. the mLOG mutation R12K was not annotated caused it didn't change anything to the mLOG-GDU1 interaction. gpilot@vt.edu 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Pratelli R., Guerra D.D., Yu S., Wogulis M., Kraft E., Frommer W.B., Callis J., Pilot G. the mLOG mutation R12K was not annotated caused it didn't change anything to the mLOG-GDU1 interaction. gpilot@vt.edu Accepted 2012-SEP-24 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. Plant Physiol. (0032-0889) 2012 Only protein-protein interactions imex curation The ubiquitin E3 ligase LOSS OF GDU2 is required for GLUTAMINE DUMPER1-induced amino acid secretion in Arabidopsis. The ubiquitin E3 ligase LOSS OF GDU2 is required for GLUTAMINE DUMPER1-induced amino acid secretion in Arabidopsis. Plant Physiol. (0032-0889) 2012 imex curation Pratelli R., Guerra D.D., Yu S., Wogulis M., Kraft E., Frommer W.B., Callis J., Pilot G. the mLOG mutation R12K was not annotated caused it didn't change anything to the mLOG-GDU1 interaction. gpilot@vt.edu 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Pratelli R., Guerra D.D., Yu S., Wogulis M., Kraft E., Frommer W.B., Callis J., Pilot G. the mLOG mutation R12K was not annotated caused it didn't change anything to the mLOG-GDU1 interaction. gpilot@vt.edu Accepted 2012-SEP-24 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. Plant Physiol. (0032-0889) 2012 Only protein-protein interactions imex curation The ubiquitin E3 ligase LOSS OF GDU2 is required for GLUTAMINE DUMPER1-induced amino acid secretion in Arabidopsis. The ubiquitin E3 ligase LOSS OF GDU2 is required for GLUTAMINE DUMPER1-induced amino acid secretion in Arabidopsis. Plant Physiol. (0032-0889) 2012 imex curation Pratelli R., Guerra D.D., Yu S., Wogulis M., Kraft E., Frommer W.B., Callis J., Pilot G. the mLOG mutation R12K was not annotated caused it didn't change anything to the mLOG-GDU1 interaction. gpilot@vt.edu 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Pratelli R., Guerra D.D., Yu S., Wogulis M., Kraft E., Frommer W.B., Callis J., Pilot G. the mLOG mutation R12K was not annotated caused it didn't change anything to the mLOG-GDU1 interaction. gpilot@vt.edu Accepted 2012-SEP-24 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. Arabidopsis cell cDNA Plant Physiol. (0032-0889) 2012 Only protein-protein interactions imex curation The ubiquitin E3 ligase LOSS OF GDU2 is required for GLUTAMINE DUMPER1-induced amino acid secretion in Arabidopsis. The ubiquitin E3 ligase LOSS OF GDU2 is required for GLUTAMINE DUMPER1-induced amino acid secretion in Arabidopsis. Plant Physiol. (0032-0889) 2012 imex curation Pratelli R., Guerra D.D., Yu S., Wogulis M., Kraft E., Frommer W.B., Callis J., Pilot G. the mLOG mutation R12K was not annotated caused it didn't change anything to the mLOG-GDU1 interaction. gpilot@vt.edu 11-Oct-2012: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Pratelli R., Guerra D.D., Yu S., Wogulis M., Kraft E., Frommer W.B., Callis J., Pilot G. the mLOG mutation R12K was not annotated caused it didn't change anything to the mLOG-GDU1 interaction. gpilot@vt.edu Accepted 2012-SEP-24 by ORCHARD 11-Oct-2012: Contacted by IntAct-Help. Plant Physiol. (0032-0889) 2012 Only protein-protein interactions imex curation gdu1_arath Protein GLUTAMINE DUMPER 1 GDU1 F28M20.80 At4g31730 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRPLSVQSKFEDVATSTSVNHHGVTPQSPWHSPVPYLFGGLAAMLGLIAFALLILACSYWRLSSSGEEDGQNVDEEKESRSGDKAANGAYEEKFLVIMAGEDLPRYLATPAMKKCTCGGHEGKMVISQEESVAKEEEKMREGEEEKVKDTGETTTTSH 6211B8ABBBA3A695 gdu5_arath Protein GLUTAMINE DUMPER 5 GDU5 F6A4.130 At5g24920 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRQFPSIRGNINEKMMTTMVESQTRSPWRTPVPYLFGGLAAMLGLIAFALLLLACSYWRLSRQTEDEEKQTESGEKVVAKAFEEKILVIMAGQNNPTFLATPVAAKICLDCVNMEKKEGQNGESKVTEENH F492ED829E802DE1 gdu4_arath Protein GLUTAMINE DUMPER 4 GDU4 F27A10.11 At2g24762 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRPLSIKPTSLDVARHATSVESFGNHRPPISPWHSPVPYLFGGLAAMLGLIAFALLILACSYWRLSTSGDDSGERVDEEKESRSGVKAASAACEEKVLVIMAGDDLPRFLATPAANKCMCGHEGRMVIFKEDGIGAGEEKMGDREKAKENEETTSQ 413DFCC110E4885F gdu2_arath Protein GLUTAMINE DUMPER 2 GDU2 F14M19.40 At4g25760 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MQTMEGRQYNYQDSINASSSMVVPHSPWHSPVPYLFGGLAAMLALICVALLILACSYWRLSGSAERDLEAGDDAKPDNDTNKTKHTEMPEKFLVIMAGDVRPTYLATPATRSEQSCTCGDHNEEEGRRG A7355B3280DDFF38 gdu3_arath Protein GLUTAMINE DUMPER 3 GDU3 LBS1 Protein LESS SUSCEPTIBLE TO BSCTV 1 MRI1.4 At5g57685 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGRQYYPPRENVEGNRTTMGGGPHSPWHSPVPYLFGGLAAMLGLIAFALLILACSYWRLSGYLDGEENQSRERDLEVGDVKPDKTAVKPVALPEKFLVIMAGNVKPTYLATPSVKTCTCDDDDDEDDDVEGSDQVVPRSSESNGETH E0FF8FD1A16A399F lofg2_arath Probable E3 ubiquitin-protein ligase LOG2 LOG2 Protein LOSS OF GDU2 RF215 RIG2 RING finger protein 215 F11F8.36 F8A24.18 At3g09770 Probable RING-type E3 ubiquitin transferase LOG2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGNISSSGGEGRRRRRRNHTAAPPPPPPPPSSSLPPPPLPTEIQANPIVFAAVTPYPNPNPNPVYQYPASYYHHPPPGAMPLPPYDHHLQHHPPHPYHNHSWAPVAMARYPYAGHMMAQPTPYVEHQKAVTIRNDVNLKKESLRLEPDPDNPGRFLVSFTFDATVSGRISVIFFAKESEDCKLTATKEDILPPITLDFEKGLGQKFKQSSGSGIDFSVFEDVELFKAAADTEIYPLAVKAEAAPSGGENEEEERSGSKNAQITQAVYEKDKGEIKIRVVKQILWVNGTRYELQEIYGIGNTVEGDDDSADDANDPGKECVICLSEPRDTTVLPCRHMCMCSGCAKVLRFQTNRCPICRQPVERLLEIKVHGNNGSGNNTGQGETVEQE D0DAAE050FA2D488 gdu7_arath Protein GLUTAMINE DUMPER 7 GDU7 MKD10.70 At5g38770 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLHRDSMVPVNSRLENMDSPILSKICAWGVMLGLFALSLFAMAYACYHKQTSNSCIEEKQGKKQVLKPLDMEPKIVVIMAGNENPTFFAKPTQINA F9BC331DF150103B lul2_arath Probable E3 ubiquitin-protein ligase LUL2 LUL2 Protein LOG2-LIKE UBIQUITIN LIGASE 2 RF269 RING finger protein 269 F4P12_110 At3g53410 Probable RING-type E3 ubiquitin transferase LUL2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGNVISGGSRPENHRDRTSPPYPNPNAQYQGNYPSPYQDCARYPYGEMASPVQYVEHQEAVTIRNDINLKKETLRLEPDEQNPGKFLLSFTFDASVPGSITVMFFAKEGKDCNLIATKEDLFPSTQVSFAKGLEQRFKQACGTGIDFSDMSEADLVEANETDVYHVAVKAEVVSEDDHPESGTPNRQITHVVLEKDHKGEYKARVVKQILWVNGNRYVLQEIYGIGNTVDDNGEDANERGKECVICLSEPRDTTVLPCRHMCMCSGCAKLLRFQTNLCPICRQPVDRLLEITVNNNDRN 63ADDCA54A48FE2A gdu6_arath Protein GLUTAMINE DUMPER 6 GDU6 T4A2.7 At3g30725 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRPTPKVEIWKSPVPYLFGGLFLLVLLIALALLSLVCTHQKPSSSSNNNHMDEEDDVGDKDAKPITREYLPKIVVILAGDNKPTCLAVPVVVPPPTSIFRCNCDNVTVIST 26C94317CC0A0ABA lul3_arath Probable E3 ubiquitin-protein ligase LUL3 Probable RING-type E3 ubiquitin transferase LUL3 LUL3 Protein LOG2-LIKE UBIQUITIN LIGASE 3 RF398 RING finger protein 398 T16G12.120 At5g19080 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGISLSKRRRDNNNNHHHPHHNPPYYYSDPPPQQPPPQNGYSYSHNYPVSTPQLSLPPPPAQPPSSSQPPPSQISYRPYGQNYHQNQYYPQQAPPYFTGYHHNGFNPMMRPVYFGPTPVAVMEPPAPYVEHQTAKKVKNDVNVNKATVRLVADDLNPGHYLVSFVFDALFDGSFTIIFFGEEESKCTIVPHLPEAFPPIKVPFQKGAGQKFLQAPGTGIDLGFFSLDDLSKPSPEEVYPLVISAETVISPSSVSEEPLVHKQITQAVLEKTNDGSFKVKVMKQILWIEGERYELQELYGIDNSITQGTAASGLEDTGGKECVICLTEPKDTAVMPCRHLCLCSDCAEELRFQTNKCPICRQPIHELVKIKVESSDEQH 48AFE2DB67E3DAFB lul1_arath Probable E3 ubiquitin-protein ligase LUL1 LUL1 Protein LOG2-LIKE UBIQUITIN LIGASE 1 RF370 RING finger protein 370 F15A17_230 MOK16.11 At5g03200 Probable RING-type E3 ubiquitin transferase LUL1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGNLISLIFCCGRRQRSNIPPAMETAPLELPPNRFVFAAVPPYLNPNPNYVDQYPGNCLPPPVTEPPMLPYNFNHLHHYPPNSYQLPHPLFHGGRYPILPPPTYVHQKAVTIRNDVNLKKKTLTLIPDPENPNRLLVSFTFDASMPGRITVVFFATEDAECNLRATKEDTLPPITFDFGEGLGQKFIQSSGTGIDLTAFKDSELFKEVDTDVFPLAVKAEATPAEEGKSGSTNVQITQVVYTKEKGEIKIEVVKQILWVNKRRYELLEIYGIENTVDGSDEGKECVVCLSEPRDTTVLPCRHMCMCSGCAKALRFQTNLCPVCRQPVEMLLEINKNG FF353C1900702147 log2-gdu1 4 5 unspecified role unspecified role prey prey O81775:p.Gly100Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G R Wed May 02 20:04:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly100arg' Tue Jun 30 16:36:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly100Arg' cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role bait bait physical association physical association Fig. 1A, Fig. 8D gdu1-log2 4 5 unspecified role unspecified role bait bait O81775:p.Gly100Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G R Wed May 02 16:05:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly100arg' Tue Jun 30 19:54:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly100Arg' cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey physical association physical association Fig. 1A, Fig. 8D lul1-gdu1 4 15 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey O81775:p.Gly100Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G R Wed May 02 15:27:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly100arg' Tue Jun 30 17:41:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly100Arg' cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1A log2-gdu2 4 8 unspecified role unspecified role prey prey cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range 10 unspecified role unspecified role bait bait physical association physical association Fig. 1A gdu2-log2 4 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association Fig. 1A log2-gdu4 4 7 unspecified role unspecified role prey prey cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range 10 unspecified role unspecified role bait bait physical association physical association Fig. 1A gdu3-log2 4 9 unspecified role unspecified role bait bait cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range 10 unspecified role unspecified role prey prey physical association physical association Fig. 1A gdu4-log2 4 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association Fig. 1A log2-gdu3 4 9 unspecified role unspecified role prey prey cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range 10 unspecified role unspecified role bait bait physical association physical association Fig. 1A log2-gdu5 4 6 unspecified role unspecified role prey prey cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range 10 unspecified role unspecified role bait bait physical association physical association Fig. 1A log2-gdu6 4 13 unspecified role unspecified role prey prey cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range 10 unspecified role unspecified role bait bait physical association physical association Fig. 1A gdu6-log2 4 13 unspecified role unspecified role bait bait cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range 10 unspecified role unspecified role prey prey physical association physical association Fig. 1A log2-gdu7 4 11 unspecified role unspecified role prey prey cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range 10 unspecified role unspecified role bait bait physical association physical association Fig. 1A lul1-gdu2 4 8 unspecified role unspecified role prey prey cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range 15 unspecified role unspecified role bait bait physical association physical association Fig. 1A lul1-gdu3 4 9 unspecified role unspecified role prey prey cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range 15 unspecified role unspecified role bait bait physical association physical association Fig. 1A lul1-gdu4 4 7 unspecified role unspecified role prey prey cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range 15 unspecified role unspecified role bait bait physical association physical association Fig. 1A lul1-gdu5 4 15 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association Fig. 1A lul1-gdu6 4 13 unspecified role unspecified role prey prey cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range 15 unspecified role unspecified role bait bait physical association physical association Fig. 1A gdu6-lul1 4 13 unspecified role unspecified role bait bait cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range 15 unspecified role unspecified role prey prey physical association physical association Fig. 1A lul2-gdu2 4 12 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association Fig. 1A gdu2-lul2 4 8 unspecified role unspecified role bait bait cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range 12 unspecified role unspecified role prey prey physical association physical association Fig. 1A lul2-gdu3 4 9 unspecified role unspecified role prey prey cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range 12 unspecified role unspecified role bait bait physical association physical association Fig. 1A gdu3-lul2 4 12 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association Fig. 1A lul3-gdu2 4 14 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association Fig. 1A gdu1_log2-1 2 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9S752:p.[Cys354Ala;Cys357Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Thu Jul 07 12:16:24 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was cys354ala-cys357ala Wed May 02 19:10:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys354ala,cys357ala' Tue Jun 30 16:43:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys354Ala;Cys357Ala]' 5 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1C log2-gdu1-1 2 10 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9S752:p.[Cys354Ala;Cys357Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Thu Jul 07 12:17:49 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was cys354ala-cys357ala Wed May 02 20:21:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys354ala,cys357ala' Tue Jun 30 17:14:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys354Ala;Cys357Ala]' 5 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1C, Fig. 4G log2-gdu1-2 2 10 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9S752:p.[Gly2Ala;Cys354Ala;Cys357Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain G A certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Wed May 02 18:28:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly2ala,cys354ala,cys357ala' Tue Jun 30 17:29:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly2Ala;Cys354Ala;Cys357Ala]' 5 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4G log2-gdu1-4 1 5 unspecified role unspecified role prey prey O81775:p.Gly100Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G R Wed May 02 15:21:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly100arg' Tue Jun 30 17:45:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly100Arg' region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association Fig. 1B log2-gdu1 2 5 unspecified role unspecified role prey prey O81775:p.Gly100Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G R Wed May 02 14:44:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly100arg' Tue Jun 30 17:36:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly100Arg' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait Q9S752:p.[Cys354Ala;Cys357Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Thu Jul 07 12:16:23 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was cys354ala-cys357ala Wed May 02 19:30:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys354ala,cys357ala' Tue Jun 30 16:57:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys354Ala;Cys357Ala]' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1C gdu1-log2 2 10 unspecified role unspecified role prey prey Q9S752:p.[Cys354Ala;Cys357Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Thu Jul 07 12:15:31 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was cys354ala-cys357ala Wed May 02 20:21:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys354ala,cys357ala' Tue Jun 30 17:47:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys354Ala;Cys357Ala]' region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait O81775:p.Gly100Arg mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain G R Wed May 02 15:35:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly100arg' Tue Jun 30 17:10:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly100Arg' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 1C gdu1-log2 3 5 unspecified role unspecified role bait bait cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey physical association physical association gdu1-lul1 3 5 unspecified role unspecified role bait bait cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 15 unspecified role unspecified role prey prey physical association physical association