mpidb The Microbial Protein Interaction Database Bacillus subtilis RapA phosphatase domain interaction with its substrate, phosphorylated Spo0F, and its inhibitor, the PhrA peptide. Bacillus subtilis RapA phosphatase domain interaction with its substrate, phosphorylated Spo0F, and its inhibitor, the PhrA peptide. J. Bacteriol. (0021-9193) 2012 imex curation Diaz A.R., Core L.J., Jiang M., Morelli M., Chiang C.H., Szurmant H., Perego M. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro in gel phosphatase in gel phosphatase assay in gel phosphatase predetermined predetermined participant predetermined Diaz A.R., Core L.J., Jiang M., Morelli M., Chiang C.H., Szurmant H., Perego M. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation Bacillus subtilis RapA phosphatase domain interaction with its substrate, phosphorylated Spo0F, and its inhibitor, the PhrA peptide. Bacillus subtilis RapA phosphatase domain interaction with its substrate, phosphorylated Spo0F, and its inhibitor, the PhrA peptide. J. Bacteriol. (0021-9193) 2012 imex curation Diaz A.R., Core L.J., Jiang M., Morelli M., Chiang C.H., Szurmant H., Perego M. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by staining molecular weight estimation by staining weight by staining Diaz A.R., Core L.J., Jiang M., Morelli M., Chiang C.H., Szurmant H., Perego M. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation phra_bacsu Phosphatase RapA inhibitor phrA gsiAB BSU12440 Phosphatase regulator A protein protein bacsu Bacillus subtilis MKSKWMSGLLLVAVGFSFTQVMVHAGETANTEGKTFHIAARNQT 95AA9E07F08D2DCB rapa_bacsu Response regulator aspartate phosphatase A rapA Glucose starvation-inducible protein A Stage 0 sporulation protein L gsiAA spo0L BSU12430 protein protein bacsu Bacillus subtilis MRMKQTIPSSYVGLKINEWYTHIRQFHVAEAERVKLEVEREIEDMEEDQDLLLYYSLMEFRHRVMLDYIKPFGEDTSQLEFSELLEDIEGNQYKLTGLLEYYFNFFRGMYEFKQKMFVSAMMYYKRAEKNLALVSDDIEKAEFAFKMAEIFYNLKQTYVSMSYAVQALETYQMYETYTVRRIQCEFVIAGNYDDMQYPERALPHLELALDLAKKEGNPRLISSALYNLGNCYEKMGELQKAAEYFGKSVSICKSEKFDNLPHSIYSLTQVLYKQKNDAEAQKKYREGLEIARQYSDELFVELFQFLHALYGKNIDTESVSHTFQFLEEHMLYPYIEELAHDAAQFYIENGQPEKALSFYEKMVHAQKQIQRGDCLYEI 8712FE59B865AEF4 sp0f_bacsu Sporulation initiation phosphotransferase F spo0F Stage 0 sporulation protein F BSU37130 protein protein bacsu Bacillus subtilis MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN 4130377E3558D698 4130377E3558D698 cmpa_bacsu Transcriptional regulatory protein ComA comA Competence protein A comA1 comAA BSU31680 protein protein bacsu Bacillus subtilis MKKILVIDDHPAVMEGTKTILETDSNLSVDCLSPEPSEQFIKQHDFSSYDLILMDLNLGGEVNGMELSKQILQENPHCKIIVYTGYEVEDYFEEAIRAGLHGAISKTESKEKITQYIYHVLNGEILVDFAYFKQLMTQQKTKPAPSSQKEQDVLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL 52D01A9740759072 52D01A9740759072 rapa-spo0f 1 5 enzyme target enzyme target substrate substrate unspecified role unspecified role region nphosres N-phosphorylated residue NPhosRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 4 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli dephosphorylation dephosphorylation reaction dephosphorylation figure 1and 5 coma-rapa-2 2 4 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 6 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association figure 4 phra-rapa-1 1 4 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli 5 enzyme target enzyme target substrate substrate unspecified role unspecified role region nphosres N-phosphorylated residue NPhosRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 3 inhibitor inhibitor unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain dephosphorylation dephosphorylation reaction dephosphorylation figure 1 RapAY224A, RapAN225A, RapAN228A, and RapAH260A proteins dephosphorylated Spo0F∼P at the same rate as the wild-type protein, but none of them was inhibited by the PhrA pentapeptide