mpidb The Microbial Protein Interaction Database Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. J. Bacteriol. (0021-9193) 2012 imex curation Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. J. Bacteriol. (0021-9193) 2012 imex curation Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions rhime Rhizobium meliloti Sinorhizobium meliloti fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. J. Bacteriol. (0021-9193) 2012 imex curation Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. J. Bacteriol. (0021-9193) 2012 imex curation Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. J. Bacteriol. (0021-9193) 2012 imex curation Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. J. Bacteriol. (0021-9193) 2012 imex curation Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. J. Bacteriol. (0021-9193) 2012 imex curation Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro phosphotransferase phosphotransferase assay phosphotransferase weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation q52884_rhiml CDO24_06225 CN171_21380 CN211_06630 GHK53_05465 cheY2 CEJ86_01705 CN070_16445 protein protein rhime Rhizobium meliloti Sinorhizobium meliloti MSLAEKIKVLIVDDQVTSRLLLGDALQQLGFKQITAAGDGEQGMKIMAQNPHHLVISDFNMPKMDGLGLLQAVRANPATKKAAFIILTAQGDRALVQKAAALGANNVLAKPFTIEKMKAAIEAVFGALK B85665853BDDC453 q52879_rhiml cheY1 CDO24_06200 CN171_21355 CN211_06605 GHK53_05490 protein protein rhime Rhizobium meliloti Sinorhizobium meliloti MKKRVLTVDDSRTIRNMLLVTLNNAGFETIQAEDGVEGLEKLDTANPDVIVTDINMPRLDGFGFIEGVRKNDRYRAVPILVLTTESDAEKKNRARQAGATGWIVKPFDPTKLIDAIERVTA 2C3AC907AE4DEC0F q52878_rhiml orf2 protein protein rhime Rhizobium meliloti Sinorhizobium meliloti MASRNSARNTLMLAPVLDLNEATVLHERLLALKGGAVAIDASAVERVGALCVQVLMAAARSWEADRLSFTFAEVSDAFIKTTQLIGADIGPLMAKEI BADD761A976D748A chea_rhime Chemotaxis protein CheA SMc03007 R00639 cheA protein protein sinorhizobium melilo Rhizobium meliloti (strain 1021) (Ensifer meliloti) Sinorhizobium meliloti Ensifer meliloti MDMNEIKEIFFQECEEQLAELESGLLKLNDGDRDPETVNAVFRAVHSIKGGAGAFGLDDLVSFAHVFETTLDCVRSNRLEPNQDVLKVMLRSADVLADLTNAARDGGGVDEARSRQLIKELEALANGELPQAAAESAPKTTPAGVAPAAPVVNEEGFQPVAFSFDDFETGDEPTIEPSTYEIVFKPKSDLYSKGNDATLLLRDLSRLGEMSIHCNMDTLPPLDRMNPEEAYFSWKISLKTDKGEEAIRSVFEFAEWDCELDVALAGGTVGMDEDLPMQPVPFDLSILEDEAQAPAGEEDRAAASEGDSRNAAVAAAQTASNVLQMAQSTARVSPENARNSQSASAAQAAAQQAASAATPTIRVDLDRVDRLINLVGELVINQAMLSQSVIENDTNGTSSINMGLEELQQLTREIQDSVMAIRAQPVKPVFQRMSRIVREIADMTGKSVRLITEGENTEVDKTVIDKLAEPLTHMIRNAVDHGLETPEKRVAAGKNPEGTVRLTAKHRSGRIVIELADDGAGINREKVRQKAIDNDLIAADANLSDEEVDNLIFHAGFSTADKISDISGRGVGMDVVKRSIQALGGRINISSKPGQGSIFTMSLPLTLAVLDGMVVTVANQTLVVPLTAIVETLQPEASAIHSFGSSQRLISIRDSFCPLVDVGRILNFRGAQANPVEGVALLVESEGGGQRALMVDAIQGQRQVVIKSLEANYTHVPGIAAATILGDGRVALILDVDAIVAASRGQSLKPEMSLAAAG 9F03A8F24EA25D5D orf2-orf2-1 5 10 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 10 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction figure 2 chea-orf2-5 5 11 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 10 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction figure 2 chea-orf2-1 2 11 unspecified role unspecified role unspecified role unspecified role q52880-- Q52880-- rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role unspecified role unspecified role q52878-- Q52878-- egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 3 chea-orf2-2 3 11 unspecified role unspecified role bait bait q52880-- Q52880-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined q52880-120-360 Q52880-120-360 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 10 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association figure 4 and 6 chea-orf2-7 1 10 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component direct interaction direct interaction figure 5 chea-chey2-1 6 11 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey direct interaction direct interaction figure 10 chea-chey1 6 11 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey direct interaction direct interaction figure 10 chea-2 4 11 putative self putative self putative self putative self ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation true Fig. 8 chea-chey1-1 7 11 phosphate donor phosphate donor unspecified role unspecified role 9 photon acceptor photon acceptor photon acceptor unspecified role unspecified role phosphotransfer phosphotransfer reaction phosphotransfer figure 9 chea-chey2-2 7 11 phosphate donor phosphate donor unspecified role unspecified role ecolx Escherichia coli 8 phosphate acceptor phosphate acceptor unspecified role unspecified role ecolx Escherichia coli phosphotransfer phosphotransfer reaction phosphotransfer figure 9 chea-orf2-8 1 11 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component direct interaction direct interaction figure 5