IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ SIRT1 Activates MAO-A in the Brain to Mediate Anxiety and Exploratory Drive. SIRT1 Activates MAO-A in the Brain to Mediate Anxiety and Exploratory Drive. Cell (0092-8674) 2011 imex curation Libert S., Pointer K., Bell E.L., Das A., Cohen D.E., Asara J.M., Kapur K., Bergmann S., Preisig M., Otowa T., Kendler K.S., Chen X., Hettema J.M., van den Oord E.J., Rubio J.P., Guarente L. Deacetylase assay has not been captured as the species of origin of the protein constructs could not be traced. leng@mit.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Libert S., Pointer K., Bell E.L., Das A., Cohen D.E., Asara J.M., Kapur K., Bergmann S., Preisig M., Otowa T., Kendler K.S., Chen X., Hettema J.M., van den Oord E.J., Rubio J.P., Guarente L. Deacetylase assay has not been captured as the species of origin of the protein constructs could not be traced. leng@mit.edu Accepted 2012-FEB-06 by MGT Cell (0092-8674) 2011 Only protein-protein interactions imex curation SIRT1 Activates MAO-A in the Brain to Mediate Anxiety and Exploratory Drive. SIRT1 Activates MAO-A in the Brain to Mediate Anxiety and Exploratory Drive. Cell (0092-8674) 2011 imex curation Libert S., Pointer K., Bell E.L., Das A., Cohen D.E., Asara J.M., Kapur K., Bergmann S., Preisig M., Otowa T., Kendler K.S., Chen X., Hettema J.M., van den Oord E.J., Rubio J.P., Guarente L. Deacetylase assay has not been captured as the species of origin of the protein constructs could not be traced. leng@mit.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-brain Mus musculus brain brain Brain [cerebrum] ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Libert S., Pointer K., Bell E.L., Das A., Cohen D.E., Asara J.M., Kapur K., Bergmann S., Preisig M., Otowa T., Kendler K.S., Chen X., Hettema J.M., van den Oord E.J., Rubio J.P., Guarente L. Deacetylase assay has not been captured as the species of origin of the protein constructs could not be traced. leng@mit.edu Accepted 2012-FEB-06 by MGT 14-Mar-2012: Contacted by JYOTI. Cell (0092-8674) 2011 Only protein-protein interactions imex curation SIRT1 Activates MAO-A in the Brain to Mediate Anxiety and Exploratory Drive. SIRT1 Activates MAO-A in the Brain to Mediate Anxiety and Exploratory Drive. Cell (0092-8674) 2011 imex curation Libert S., Pointer K., Bell E.L., Das A., Cohen D.E., Asara J.M., Kapur K., Bergmann S., Preisig M., Otowa T., Kendler K.S., Chen X., Hettema J.M., van den Oord E.J., Rubio J.P., Guarente L. Deacetylase assay has not been captured as the species of origin of the protein constructs could not be traced. leng@mit.edu 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-n2a Mouse neuroblastoma cells n2a Murine neuroblastoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Libert S., Pointer K., Bell E.L., Das A., Cohen D.E., Asara J.M., Kapur K., Bergmann S., Preisig M., Otowa T., Kendler K.S., Chen X., Hettema J.M., van den Oord E.J., Rubio J.P., Guarente L. Deacetylase assay has not been captured as the species of origin of the protein constructs could not be traced. leng@mit.edu Accepted 2012-FEB-06 by MGT 14-Mar-2012: Contacted by JYOTI. Cell (0092-8674) 2011 Only protein-protein interactions imex curation maoa_mouse_gene Amine oxidase [flavin-containing] A gene gene mouse Mus musculus Mouse hen2_human Helix-loop-helix protein 2 NHLH2 BHLHA34 HEN2 KIAA0490 Class A basic helix-loop-helix protein 34 Nescient helix loop helix 2 protein protein human Homo sapiens Human MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV 083730499F610AAE hen2_mouse Helix-loop-helix protein 2 Nhlh2 Hen2 Nescient helix loop helix 2 protein protein mouse Mus musculus Mouse MMLSPDQAADSDHPSSTHSDPESLGGADTKVLGSVSDLEPVEEADGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV E7872BF22A601405 sir1_mouse NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 Sirt1 Sir2l1 SIR2alpha SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein mouse Mus musculus Mouse MADEVALALQAAGSPSAAAAMEAASQPADEPLRKRPRRDGPGLGRSPGEPSAAVAPAAAGCEAASAAAPAALWREAAGAAASAEREAPATAVAGDGDNGSGLRREPRAADDFDDDEGEEEDEAAAAAAAAAIGYRDNLLLTDGLLTNGFHSCESDDDDRTSHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRILQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRPQKELVHLSELPPTPLHISEDSSSPERTVPQDSSVIATLVDQATNNNVNDLEVSESSCVEEKPQEVQTSRNVENINVENPDFKAVGSSTADKNERTSVAETVRKCWPNRLAKEQISKRLEGNQYLFVPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPLEDESEIEEFYNGLEDDTERPECAGGSGFGADGGDQEVVNEAIATRQELTDVNYPSDKS DIP protein Q923E4 original sequence version: 83 DIP protein Q923E4 original sequence version: 135 7F15625E29433119 sir1_human NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 SIRT1 SIR2L1 SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein human Homo sapiens Human MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS DIP protein Q96EB6 original sequence version: 140 DIP protein Q96EB6 original sequence version: 71 DIP protein Q96EB6 original sequence version: 125 DIP protein Q96EB6 original sequence version: 115 DIP protein Q96EB6 original sequence version: 63 DIP protein Q96EB6-1 original sequence version: 102 DIP protein Q96EB6 original sequence version: 102 DIP protein Q96EB6 original sequence version: 98 DIP protein Q96EB6 original sequence version: 144 DIP protein Q96EB6 original sequence version: 120 DIP protein Q96EB6-1 original sequence version: 120 DIP protein Q96EB6 original sequence version: 113 DIP protein Q96EB6-1 original sequence version: 117 2D3BEA6D73DA229F nhlh2-sirt1 1 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Supp. Fig. 3B sirt1-nhlh2 1 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Supp. Fig. 3C sirt1-nhlh2-1 3 5 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 3E nhlh2-sirt1-1 3 8 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 3D sirt1-maoa 2 4 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait association association Fig. 3A