MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Minor pseudopilin self-assembly primes type II secretion pseudopilus elongation. Minor pseudopilin self-assembly primes type II secretion pseudopilus elongation. EMBO J. (0261-4189) 2012 imex curation Cisneros DA., Bond PJ., Pugsley AP., Campos M., Francetic O. cisneros@pasteur.fr Only protein-protein interactions ecoli Escherichia coli (strain K12) pull down pull down predetermined predetermined participant predetermined Cisneros DA., Bond PJ., Pugsley AP., Campos M., Francetic O. cisneros@pasteur.fr EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation Minor pseudopilin self-assembly primes type II secretion pseudopilus elongation. Minor pseudopilin self-assembly primes type II secretion pseudopilus elongation. EMBO J. (0261-4189) 2012 imex curation Cisneros DA., Bond PJ., Pugsley AP., Campos M., Francetic O. cisneros@pasteur.fr Only protein-protein interactions ecoli Escherichia coli (strain K12) 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cisneros DA., Bond PJ., Pugsley AP., Campos M., Francetic O. cisneros@pasteur.fr EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation h3n8q1_9entr HMPREF9694_04146 protein protein klebsiella michiganensis klebsiella michiganensis MIRRSSGFTLVEMLLALAILAALSVAAVTVLQNVMRADTLTRDKGGRMQALQQTFSQMAADFSQIIPRRSRDSASLFFAGRFQLSSDDWAIAFSRNGWPNPLGLLPRSEIQNVSYRLRDSQLERLSYEQQDPLPGSLPTVTVMLRNVQAFGLRFYASGRWQDEWLQTQTLPQGLEVTLTLEPYGEIRRLFLLTPGGSR The sequence has been withdrawn from uniprot. mint 7CE2D7285E7FCCFD h3n8q2_9entr HMPREF9694_04147 protein protein klebsiella michiganensis klebsiella michiganensis MKKQSGMTLIEVMVALVVFALAGLSVMQATLQQTRQLGRMEEKTLASWLADNQLVQLRLENRWPALSWSETTVQAAGVSWHIRWQGVETDLPQLRALDVEVRHAKSDKTAISSLRTYVTSP The sequence has been withdrawn from uniprot. mint 98CFE85953F37A7A h3n8q0_9entr Type II secretion system protein K HMPREF9694_04145 protein protein klebsiella michiganensis klebsiella michiganensis MNNRQRGVALLMVLLILALMMVLASAMTERSARMYQQTATTLDNLQAKWYALGAETLAAALLQRDAIDSPNQTHLAQNWAQQGRRFMVNDGEIYATMTDAQACFNLNAINQRGDDESDEIPYPAQIFTRLLENLGSEPLRALQLTAALRDWVDNDRQALLNGAEDEVYMAQSPGYLTGNQPLQDVSELRLLAGMDAALYQRLLPFVCALPEDALQVNVNTLQPAQAALLAAIFPAELTVSEARQLVQTRAATGWSSVAAFLSQPTLQKIDTAAARPWLAVRSERFIATFSVVMGSARYQQRSLLQKQGRTFGVVQRRYGIYWVADE The sequence has been withdrawn from uniprot. mint 58453709ABC0555A gcn4_yeast General control transcription factor GCN4 ARG9 GCN4 AAS3 Amino acid biosynthesis regulatory protein AAS101 General control protein GCN4 YEL009C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSEYQPSLFALNPMGFSPLDGSKSTNENVSASTSTAKPMVGQLIFDKFIKTEEDPIIKQDTPSNLDFDFALPQTATAPDAKTVLPIPELDDAVVESFFSSSTDSTPMFEYENLEDNSKEWTSLFDNDIPVTTDDVSLADKAIESTEEVSLVPSNLEVSTTSFLPTPVLEDAKLTQTRKVKKPNSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAARRSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER 2ED1B8E35D509578 2ED1B8E35D509578 h3n8q2-h3n8q1 2 PulJ 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PulI 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4a mint gcn4-gcn4-4 2 Zip 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Zip 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined binding site binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4a domino mint h3n8q0-h3n8q2 1 PulI 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell PulK 5 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4f mint