IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Sec22b regulates phagosomal maturation and antigen crosspresentation by dendritic cells. Sec22b regulates phagosomal maturation and antigen crosspresentation by dendritic cells. Cell (0092-8674) 2011 imex curation Cebrian I., Visentin G., Blanchard N., Jouve M., Bobard A., Moita C., Enninga J., Moita L.F., Amigorena S., Savina A. Colocalizations not captured as appear to be indicative of subcellular location not interactions. sebastian.amigorena@curie.fr, ariel.savina@curie.fr 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions human-bmdc Homo sapiens Bone Marrow derived dendritic cells bmdm-1 bone marrow-derived macrophage anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cebrian I., Visentin G., Blanchard N., Jouve M., Bobard A., Moita C., Enninga J., Moita L.F., Amigorena S., Savina A. Colocalizations not captured as appear to be indicative of subcellular location not interactions. sebastian.amigorena@curie.fr, ariel.savina@curie.fr Accepted 2012-JAN-27 by PPORRAS Cell (0092-8674) 2011 Only protein-protein interactions imex curation stx4_human Syntaxin-4 Renal carcinoma antigen NY-REN-31 STX4 STX4A protein protein human Homo sapiens Human MRDRTHELRQGDDSSDEEDKERVALVVHPGTARLGSPDEEFFHKVRTIRQTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQVTRQALNEISARHSEIQQLERSIRELHDIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICVSITVVLLAVIIGVTVVG 5084FD1C49A86BAA stx5_human Syntaxin-5 STX5 STX5A protein protein human Homo sapiens Human MIPRKRYGSKNTDQGVYLGLSKTQVLSPATAGSSSSDIAPLPPPVTLVPPPPDTMSCRDRTQEFLSACKSLQTRQNGIQTNKPALRAVRQRSEFTLMAKRIGKDLSNTFAKLEKLTILAKRKSLFDDKAVEIEELTYIIKQDINSLNKQIAQLQDFVRAKGSQSGRHLQTHSNTIVVSLQSKLASMSNDFKSVLEVRTENLKQQRSRREQFSRAPVSALPLAPNHLGGGAVVLGAESHASKDVAIDMMDSRTSQQLQLIDEQDSYIQSRADTMQNIESTIVELGSIFQQLAHMVKEQEETIQRIDENVLGAQLDVEAAHSEILKYFQSVTSNRWLMVKIFLILIVFFIIFVVFLA EE8616A226888501 sc22b_human Vesicle-trafficking protein SEC22b SEC22B SEC22L1 SEC22 vesicle-trafficking protein homolog B SEC22 vesicle-trafficking protein-like 1 ER-Golgi SNARE of 24 kDa protein protein human Homo sapiens Human MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL DIP protein O75396 original sequence version: 126 29B4C55961C5A044 sec22b-stx5 1 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Supp. Fig. 1C sec22b-stx4 1 4 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey physical association physical association Supp. Fig. 1D