IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structural basis and sequence rules for substrate recognition by Tankyrase explain the basis for cherubism disease. Structural basis and sequence rules for substrate recognition by Tankyrase explain the basis for cherubism disease. Cell (0092-8674) 2011 imex curation Guettler S., LaRose J., Petsalaki E., Gish G., Scotter A., Pawson T., Rottapel R., Sicheri F. Apoptosis - Interactions involving proteins with a function related to apoptosis EBI-5328461 - Fig. 1B/C- I have used the longer construct as 'sufficient to bind' as this has the lowest Kd - others are described in a comment. Also invoked the 'matching synthetic peptide to other species in assay' rule as could be either human, mouse or rat. For Fig. 4B/Table S2 I have used ARC4 and Kd's given in main text, as these are slightly different from those in S2. I have not included the data from the 153 synthetic peptides screened to derive the optimal consensus sequence (Figures 5A and S6A and Table S3) as I can see no benefit to the users in capturing this data. I have captured the final results (Fig. 5B - EBI-5333304). pawson@lunenfeld.ca, rottapel@uhnres.utoronto.ca, sicheri@lunenfeld.ca Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Guettler S., LaRose J., Petsalaki E., Gish G., Scotter A., Pawson T., Rottapel R., Sicheri F. Apoptosis - Interactions involving proteins with a function related to apoptosis EBI-5328461 - Fig. 1B/C- I have used the longer construct as 'sufficient to bind' as this has the lowest Kd - others are described in a comment. Also invoked the 'matching synthetic peptide to other species in assay' rule as could be either human, mouse or rat. For Fig. 4B/Table S2 I have used ARC4 and Kd's given in main text, as these are slightly different from those in S2. I have not included the data from the 153 synthetic peptides screened to derive the optimal consensus sequence (Figures 5A and S6A and Table S3) as I can see no benefit to the users in capturing this data. I have captured the final results (Fig. 5B - EBI-5333304). pawson@lunenfeld.ca, rottapel@uhnres.utoronto.ca, sicheri@lunenfeld.ca Accepted 2012-FEB-10 by JYOTI Cell (0092-8674) 2011 Only protein-protein interactions imex curation Structural basis and sequence rules for substrate recognition by Tankyrase explain the basis for cherubism disease. Structural basis and sequence rules for substrate recognition by Tankyrase explain the basis for cherubism disease. Cell (0092-8674) 2011 imex curation Guettler S., LaRose J., Petsalaki E., Gish G., Scotter A., Pawson T., Rottapel R., Sicheri F. Apoptosis - Interactions involving proteins with a function related to apoptosis EBI-5328461 - Fig. 1B/C- I have used the longer construct as 'sufficient to bind' as this has the lowest Kd - others are described in a comment. Also invoked the 'matching synthetic peptide to other species in assay' rule as could be either human, mouse or rat. For Fig. 4B/Table S2 I have used ARC4 and Kd's given in main text, as these are slightly different from those in S2. I have not included the data from the 153 synthetic peptides screened to derive the optimal consensus sequence (Figures 5A and S6A and Table S3) as I can see no benefit to the users in capturing this data. I have captured the final results (Fig. 5B - EBI-5333304). pawson@lunenfeld.ca, rottapel@uhnres.utoronto.ca, sicheri@lunenfeld.ca Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Guettler S., LaRose J., Petsalaki E., Gish G., Scotter A., Pawson T., Rottapel R., Sicheri F. Apoptosis - Interactions involving proteins with a function related to apoptosis EBI-5328461 - Fig. 1B/C- I have used the longer construct as 'sufficient to bind' as this has the lowest Kd - others are described in a comment. Also invoked the 'matching synthetic peptide to other species in assay' rule as could be either human, mouse or rat. For Fig. 4B/Table S2 I have used ARC4 and Kd's given in main text, as these are slightly different from those in S2. I have not included the data from the 153 synthetic peptides screened to derive the optimal consensus sequence (Figures 5A and S6A and Table S3) as I can see no benefit to the users in capturing this data. I have captured the final results (Fig. 5B - EBI-5333304). pawson@lunenfeld.ca, rottapel@uhnres.utoronto.ca, sicheri@lunenfeld.ca Accepted 2012-FEB-10 by JYOTI Cell (0092-8674) 2011 Only protein-protein interactions imex curation Structural basis and sequence rules for substrate recognition by Tankyrase explain the basis for cherubism disease. Structural basis and sequence rules for substrate recognition by Tankyrase explain the basis for cherubism disease. Cell (0092-8674) 2011 imex curation Guettler S., LaRose J., Petsalaki E., Gish G., Scotter A., Pawson T., Rottapel R., Sicheri F. Apoptosis - Interactions involving proteins with a function related to apoptosis EBI-5328461 - Fig. 1B/C- I have used the longer construct as 'sufficient to bind' as this has the lowest Kd - others are described in a comment. Also invoked the 'matching synthetic peptide to other species in assay' rule as could be either human, mouse or rat. For Fig. 4B/Table S2 I have used ARC4 and Kd's given in main text, as these are slightly different from those in S2. I have not included the data from the 153 synthetic peptides screened to derive the optimal consensus sequence (Figures 5A and S6A and Table S3) as I can see no benefit to the users in capturing this data. I have captured the final results (Fig. 5B - EBI-5333304). pawson@lunenfeld.ca, rottapel@uhnres.utoronto.ca, sicheri@lunenfeld.ca Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Guettler S., LaRose J., Petsalaki E., Gish G., Scotter A., Pawson T., Rottapel R., Sicheri F. Apoptosis - Interactions involving proteins with a function related to apoptosis EBI-5328461 - Fig. 1B/C- I have used the longer construct as 'sufficient to bind' as this has the lowest Kd - others are described in a comment. Also invoked the 'matching synthetic peptide to other species in assay' rule as could be either human, mouse or rat. For Fig. 4B/Table S2 I have used ARC4 and Kd's given in main text, as these are slightly different from those in S2. I have not included the data from the 153 synthetic peptides screened to derive the optimal consensus sequence (Figures 5A and S6A and Table S3) as I can see no benefit to the users in capturing this data. I have captured the final results (Fig. 5B - EBI-5333304). pawson@lunenfeld.ca, rottapel@uhnres.utoronto.ca, sicheri@lunenfeld.ca Accepted 2012-FEB-10 by JYOTI Cell (0092-8674) 2011 Only protein-protein interactions imex curation tnks2_human Poly [ADP-ribose] polymerase tankyrase-2 TNKS2 PARP5B TANK2 TNKL Poly [ADP-ribose] polymerase 5B TNKS-2 TRF1-interacting ankyrin-related ADP-ribose polymerase 2 Tankyrase II Tankyrase-like protein Tankyrase-related protein ADP-ribosyltransferase diphtheria toxin-like 6 Protein poly-ADP-ribosyltransferase tankyrase-2 Tankyrase-2 protein protein human Homo sapiens Human MSGRRCAGGGAACASAAAEAVEPAARELFEACRNGDVERVKRLVTPEKVNSRDTAGRKSTPLHFAAGFGRKDVVEYLLQNGANVQARDDGGLIPLHNACSFGHAEVVNLLLRHGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGAEPTIRNTDGRTALDLADPSAKAVLTGEYKKDELLESARSGNEEKMMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHNKSAIDLAPTPQLKERLAYEFKGHSLLQAAREADVTRIKKHLSLEMVNFKHPQTHETALHCAAASPYPKRKQICELLLRKGANINEKTKEFLTPLHVASEKAHNDVVEVVVKHEAKVNALDNLGQTSLHRAAYCGHLQTCRLLLSYGCDPNIISLQGFTALQMGNENVQQLLQEGISLGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAALLDAAKKGCLARVKKLSSPDNVNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGADVNAQDKGGLIPLHNAASYGHVDVAALLIKYNACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTLKNQEGQTPLDLVSADDVSALLTAAMPPSALPSCYKPQVLNGVRSPGATADALSSGPSSPSSLSAASSLDNLSGSFSELSSVVSSSGTEGASSLEKKEVPGVDFSITQFVRNLGLEHLMDIFEREQITLDVLVEMGHKELKEIGINAYGHRHKLIKGVERLISGQQGLNPYLTLNTSGSGTILIDLSPDDKEFQSVEEEMQSTVREHRDGGHAGGIFNRYNILKIQKVCNKKLWERYTHRRKEVSEENHNHANERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPVHKDRSCYICHRQLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPEGMVDG DIP protein Q9H2K2 original sequence version: 154 DIP protein Q9H2K2 original sequence version: 107 4C8B3B8D97CEF704 mcl1_human Induced myeloid leukemia cell differentiation protein Mcl-1 Bcl-2-related protein EAT/mcl1 mcl1/EAT MCL1 BCL2L3 Bcl-2-like protein 3 protein protein human Homo sapiens Human MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR DIP protein Q07820 original sequence version: 85 DIP protein Q07820 original sequence version: 89 DIP protein Q07820 original sequence version: 113 DIP protein Q07820 original sequence version: 168 DIP protein Q07820-1 original sequence version: 113 D85821AC59275F1F 3bp2_human SH3 domain-binding protein 2 SH3BP2 3BP2 RES4-23 protein protein human Homo sapiens Human MAAEEMHWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLKWPLRFVIIHKRCVYYFKSSTSASPQGAFSLSGYNRVMRAAEETTSNNVFPFKIIHISKKHRTWFFSASSEEERKSWMALLRREIGHFHEKKDLPLDTSDSSSDTDSFYGAVERPVDISLSPYPTDNEDYEHDDEDDSYLEPDSPEPGRLEDALMHPPAYPPPPVPTPRKPAFSDMPRAHSFTSKGPGPLLPPPPPKHGLPDVGLAAEDSKRDPLCPRRAEPCPRVPATPRRMSDPPLSTMPTAPGLRKPPCFRESASPSPEPWTPGHGACSTSSAAIMATATSRNCDKLKSFHLSPRGPPTSEPPPVPANKPKFLKIAEEDPPREAAMPGLFVPPVAPRPPALKLPVPEAMARPAVLPRPEKPQLPHLQRSPPDGQSFRSFSFEKPRQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSVGSMVEHYHTHVLPSHQSLLLRHPYGYTGPR 69E6846A4F6D8F15 lcap_human Leucyl-cystinyl aminopeptidase OTASE Oxytocinase Insulin-regulated membrane aminopeptidase Insulin-responsive aminopeptidase Placental leucine aminopeptidase LNPEP protein protein human Homo sapiens Human MEPFTNDRLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRGSRLLVRGLGEHEMEEDEEDYESSAKLLGMSFMNRSSGLRNSATGYRQSPDGACSVPSARTMVVCAFVIVVAVSVIMVIYLLPRCTFTKEGCHKKNQSIGLIQPFATNGKLFPWAQIRLPTAVVPLRYELSLHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYHGQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVAFIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLVAIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWWNDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQTLDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMKPEIQPSDTSYLWHIPLSYVTEGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINPYVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLEKLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAMKLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASSEDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGSYTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKSLTWWL F84C0EA9D48DC2C0 fat4_mouse Protocadherin Fat 4 Fat4 Fatj FAT tumor suppressor homolog 4 Fat-like cadherin protein FAT-J protein protein mouse Mus musculus Mouse MNLAANRAPGRRRLPLPSPSLCQLLRVWGLLSLLPGSARVQAAEQRQVFQVMEEQPPGTLVGTIPTRPGFTYRLSESHALFAINSSTGALYTTATIDRESLPSDVVNLVVLSSSPTYPTEVRVLVRDLNDNAPVFPDPSIVVTFKEDSGSGRQVILDTATDSDIGSNGVDHHSYRIVSGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQMDPETGLITVREPLDFEARRQYSLTVQATDRGVPSLTGRAEAFIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQRSKVPNLSLIKVASALDRERIPSYNLTVSVSDNSGAPPTAEVQARSSVASLVIFVNDINDHPPVFEQQVYRVNLSEEVPPGSYVSGVSATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTSAAGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTVLDVNDEKPVFSQPEGYEVSVVENAPTGTELLVLGATDRDLGDNGTVRFSLQEAENDQRLFRLDPVSGRLSTASSLDREEQAFYCLSILATDLGSPPQSSTAQVNVSLLDINDNSPVFYPVQYFAHIQENEPGGSYVTTVSATDPDMGPNGTVKYSISAGDRSRFQIHAKSGVISTKMALDREEKTAYQLQVVATDGGNLQSPNQAIVTVTVLDTQDNPPVFSQAAYSFVVFENVALGYHVGSVSATTMDLNANISYLITTGDQRGMFAMNPVTGQLTTASVIDREEQSFYQLKIVASGGAVTGDTVVNITVKDLNDNAPHFLQAVESINAVENWQAGHSIFQAKAVDPDEGVNGRVLYSLKQNPKNLFTINEQNGNISLLGALDVHAGSYQVEIVASDMGVPQLSSSILLTVYVHDVNDNPPVFDQISYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTITDGNNGDAFGIFPDGQLYIKSELDRELQDRYVLLVVASDRAVEPLSATVNVTVLLEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYAFEVTQPNFELHAVTGEITSTHKFDRESLMRRRGTAVFSFTVTAMDRGLPQPLKDQATVHVYMKDINDNAPKFLKDFYQATVSETATNLTQVLRVSASDVDEGSNGLIHYSILKGNEERQFAIDSFSGQVTLVGKLDYEATSAYSLLIQAVDSGAIPLNSTCTLSIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGVNADLHYTITGSNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIQVRDFNDNPPSFPPGDIFKSIVENIPLGTSVISVTAHDPDADINGQLSYAIIQQMPRGNHFSIDEVKGTIYTSAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAMIGSVLTTIMAADPDEGANGEVEYEILNGDTDTFTVDRYSGDLRVASALVPSQLIYNLIVSATDLGPERRKSTTELTVILQGLDGPVFTQTKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRQTGVIQTAAILDREQGACLYLVDVYAIEKSSAFPRTQRAEVEITLQDINDNPPVFPTDTLDLTVEENIGDGSKIMQLTAMDADEGANALVTYALISGADDSFRIDPESGDLIATKRLDREHRSKYSLLVRADDGLQSSDMRINITISDVNDHTPRFSRPVYSFDIPEDTTPGSLVAAILATDDDSGVNGEISYVVEEDDGDGVFFLNLVTGVFNLTRALDYETQQYYILTVRAEDGGGQSTTIRAYFNILDVNDNPPVFSMSSYSTSLMENLPLGSTVLVFNVTDADDGVNSQLSYSIASGDSLGQFAVDKHGVLKTLKALDRESQSFYNLVIQVHDLPQPPTSRFTSTAQVSIILLDVNDNPPMFLSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPSGNKFSIGTIDGEVHLTGELDREEVSNYSLTVVATDKGQPPLSSSTEVVVMVLDINDNNPVFAQAMYRVQIKENILTGTDIIQVSAADNDEGTNGQVRYGIVGGNTHQEFRIDSVTGAITVAKSLDRETTPAYTLTVQATDRGSSPRTDSCTVAITLLDMNDFVPVFELSPYSVNVPENLGTLPRAILQVVARDDDQGPNSQLSYVLLGGNEDNAFVLTASGELRVTQSLDREARDHFVLVVTAADAGSPALTGTGTINIIVDDINDNVPTFANNMYLTSIAEDARTGTDVLLVNASDADAAANAVISYSIIGGNSQFTINPSTGQIITSALLDRETKDNYTLVVVASDAGSPESLSSSTSVLVTITDVNDNPPRFQHHPYVTHIPSPTPPGSFVFAVTVTDADIGSNSELHYSLSGRNSEKFHIDPLRGAIMAAGPLSGASEVTFSVHVKDGGSFPKTDSTTVTVRFANKADFPKVRAKEQTFMFPENQPVGTLVTTITGSSLRGETLSYYIASGNLGDTFQIDPLTGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDINDNAPTFEEDPFVSEILENLSPRKILTVSATDKDSGPNGQLDYEIVNGNQESSFTINHATGEIRSIRPLDREKISHYELTVKSSDKGSPSQSTSVKVIISILDENDNAPRFSQIFSAYVSENSPLGYTVTRVTTSDEDIGINAISRYSIVDTSLPFTINPNTGDIVISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDINDNTPRFSRPSYYLDCPELPELGSRVTQVSATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQVLKYQNVSGFSNVNINRHSFIVTASDRGNPSLLSETTVTINTVDSNDNPPQFLQNKYFTPVTKNVKVGTKLIKVTAVDDKDFGLNSEVEYFVSDGNHLGKFKLDNDTGWISIASSLVSDLNQNFLIRVTAKDKGNPPLSSQAVVHITVTEENYHTPEFSQNHISATIPESHSIGSVVRTVSARDRDTAMNGLISYNIISGNEEGIFAINSSTGVVTLAKALDYEMSSKHEMTISATDGGWVARTGYCSLTVSVIDVNDNSPVFVPDEFFPTVMENAPSGTTVIHLNATDADSGANAVIAYTVQSSDSDLFVIDPNMGVITTQGFLDFETKQSYHLTVKAFNVPDEEKCSFATVDIQLKGTNEYVPRFVSKLYYFEVSEAASRGTAVGEVFASDRDMGADGEVHYLIFGNSRKKGFQINKMTGQIYVSGLLDREKEERVSLKVLAKNFGNIRGADIDEVTVNITVLDANDPPVFSLSTYRVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTSGLDRESLPVYNLTVLAVDSGTPSATGSASLVVTLEDINDNGPVLTVSEGEVLENKRPGTLVMTLQSTDPDLPPNQGPFNYYLLSTGPATNYFSLSTAGVLSTTREIDREQIADFYLSVVTRDSGAPQMSSTGTVHITVLDQNDNPSQSRTVEIFVNYYGNLFPGGTLGSVKPQDPDVLDSFHCSLTSGVTSLFSIPAGSCDLSSQPRSTDGTFDLTVVSSDGVHSTVTNNIRVFFAGFSNATIDNSILLRVGVPTVKDFLTNHYLHFLRIASSQLTGLGTAVQLYAAYEENNRTFLLAAVKRNNNQYVNPSGVATFFESIKEILLRQSGVKVESVDHDPCIHGPCQNGGSCLRRLAVGSALKIQESLPVIIVANEPLQPSQCKCVPGYAGSWCEVDIDECLPAPCHNGGTCHNLVGGFSCSCPEGFTGRACERDINECLPSPCKHGAVCQNFPGGFNCVCKTGYTGKMCESSVNYCECNPCFNGGSCQSGVESYYCHCPFGVFGKHCELNSYGFEELSYMEFPSLDPNNNYIYVKFATIKSHALLLYNYDNQTGERAEFLALEIAEERLRFSYNLGSGTYKLTTMKKVSDGQFHTVIARRAGMAASLTVDSCSENQEPGYCTVSNVAVSDDWTLDVQPNRVTVGGIRSLEPILQRRGHVESHDFVGCVMEFAVNGRPLEPSQALAAQGILDQCPRLEGTCARNPCQHGGTCVDFWSWQQCQCMEGLTGKYCEKSVTPDTALSLEGKGRLDYHMSQSEKREYLLTQSIRDTTLEPFGVNSLEVKFRTRSENGILIHIQESSNYTTVKIKNGKVHFTSDAGVAGKVERIIPEAYIADGHWHTFRISKNGSITVLSVDRIHNRDIVHPTQDFGGIEVLSMSLGGIPPNQAHRDTQTGFNGCIASVLYGGESLPFSGKHSLASISKTDPSVKIGCRGPNICASNPCWGDLLCINQWYAYKCVPPGDCASHPCQNGGSCEPGLLSGYTCSCPESHTGRTCETVVACLGVLCPQGKVCKAGSPGGHVCVQSQGPDEISLPLWAVPAIVGSCATALALLVLSLILCNQCRGKMPKNPKEEKKPKEKKKKGSENVAFDDPDNIPPYGDDLAVRKQPEGNPKPDIIERENPYLIFDETDIPHNSETIPSAPLASPEQEIEHYDIDNASSIAPSDADIIQHYKQFRSHTPKFSIQRHSPLGFARQSPMPLGASSLTYQPSSYGQGLRTSSLSHSACPTPNPLSRHSPAPFSKPSAFYRNSPARELHLPLRDGGTLEMHGDPCQPGMFNYATRLGRRSKSPQAMASHGSRPGSRLKQPIAQIPLESSPPVGLSIEEVERLNTPRPRNPSICSADHGRSSSEEDCRRPLSRTRNPADGIPAPESSSDSDSHDSFTCSEMEYDREKPVVYTSRMPKLSQVNESDADDEDNYGARLKPRRYHGRRAEGGPVGTPAAASGAADSTLKLGQQAGNFNWDNLLNWGPGFGHYVDVFKDLASLPEKAAGNEEGKSGAAKPAAKDGEAEQYV D0436BAC3162CFD2 bcr_human Breakpoint cluster region protein Renal carcinoma antigen NY-REN-26 BCR BCR1 D22S11 protein protein human Homo sapiens Human MVDPVGFAEAWKAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSYDRQRWGFRRAAQAPDGASEPRASASRPQPAPADGADPPPAEEPEARPDGEGSPGKARPGTARRPGAAASGERDDRGPPASVAALRSNFERIRKGHGQPGADAEKPFYVNVEFHHERGLVKVNDKEVSDRISSLGSQAMQMERKKSQHGAGSSVGDASRPPYRGRSSESSCGVDGDYEDAELNPRFLKDNLIDANGGSRPPWPPLEYQPYQSIYVGGMMEGEGKGPLLRSQSTSEQEKRLTWPRRSYSPRSFEDCGGGYTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTYRMFRDKSRSPSQNSQQSFDSSSPPTPQCHKRHRHCPVVVSEATIVGVRKTGQIWPNDGEGAFHGDADGSFGTPPGYGCAADRAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGSRDALVSGALESTKASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEMAEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDELEAVPNIPLVPDEELDALKIKISQIKNDIQREKRANKGSKATERLKKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDYERAEWRENIREQQKKCFRSFSLTSVELQMLTNSCVKLQTVHSIPLTINKEDDESPGLYGFLNVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTAEPNWNEEFEIELEGSQTLRILCYEKCYNKTKIPKEDGESTDRLMGKGQVQLDPQALQDRDWQRTVIAMNGIEVKLSVKFNSREFSLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKEAVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAPDSKRQSILFSTEV 4BF66FA1E9D205FE axin1_human Axin-1 Axis inhibition protein 1 AXIN1 AXIN protein protein human Homo sapiens Human MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTATPRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFACTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPAMFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPTLNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRVSSSRRYSEGREFRYGSWREPVNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESVQVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEEEGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLRTPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKSGAKLDAAGLHHHRHVHHHVHHSTARPKEQVEAEATRRAQSSFAWGLEPHSHGARSRGYSESVGAAPNASDGLAHSGKVGVACKRNAKKAESGKSASTEVPGASEDAEKNQKIMQWIIEGEKEISRHRRTGHGSSGTRKPQPHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKRASRAPSKQRYVQEVMRRGRACVRPACAPVLHVVPAVSDMELSETETRSQRKVGGGSAQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEVREDEAVLPVFEEKIIGKVEKVD DIP protein O15169 original sequence version: 118 DIP protein O15169 original sequence version: 125 DIP protein O15169-1 original sequence version: 140 DIP protein O15169 original sequence version: 132 10779173F5092F3F disc1_mouse Disrupted in schizophrenia 1 homolog Disc1 protein protein mouse Mus musculus Mouse MQGGGPRGAPIHSPSHGADSGHGLPPAVAPQRRRLTRRPGYMRSTAGSGIGFLSPAVGMPHPSSAGLTGQQSQHSQSKAGQCGLDPGSHCQASLVGKPFLKSSLVPAVASEGHLHPAQRSMRKRPVHFAVHSKNDSRQSERLTGSFKPGDSGFWQELLSSDSFKSLAPSLDAPWNKGSRGLKTVKPLASPALNGPADIASLPGFQDTFTSSFSFIQLSLGAAGERGEAEGCLPSREAEPLHQRPQEMAAEASSSDRPHGDPRHLWTFSLHAAPGLADLAQVTRSSSRQSECGTVSSSSSDTGFSSQDASSAGGRGDQGGGWADAHGWHTLLREWEPMLQDYLLSNRRQLEVTSLILKLQKCQEKVVEDGDYDTAETLRQRLEELEQEKGRLSWALPSQQPALRSFLGYLAAQIQVALHGATQRAGSDDPEAPLEGQLRTTAQDSLPASITRRDWLIREKQRLQKEIEALQARMSALEAKEKRLSQELEEQEVLLRWPGCDLMALVAQMSPGQLQEVSKALGETLTSANQAPFQVEPPETLRSLRERTKSLNLAVRELTAQVCSGEKLCSSLRRRLSDLDTRLPALLEAKMLALSGSCFSTAKELTEEIWALSSEREGLEMFLGRLLALSSRNSRRLGIVKEDHLRCRQDLALQDAAHKTRMKANTVKCMEVLEGQLSSCRCPLLGRVWKADLETCQLLMQSLQLQEAGSSPHAEDEEQVHSTGEAAQTAALAVPRTPHPEEEKSPLQVLQEWDTHSALSPHCAAGPWKEDSHIVSAEVGEKCEAIGVKLLHLEDQLLGAMYSHDEALFQSLQGELQTVKETLQAMILQLQPTKEAGEASASYPTAGAQETEA B55A850B15028E6F dido1_human Death-inducer obliterator 1 DIDO1 Death-associated transcription factor 1 C20orf158 DATF1 KIAA0333 protein protein human Homo sapiens Human MDDKGDPSNEEAPKAIKPTSKEFRKTWGFRRTTIAKREGAGDAEADPLEPPPPQQQLGLSLRRSGRQPKRTERVEQFLTIARRRGRRSMPVSLEDSGEPTSCPATDAETASEGSVESASETRSGPQSASTAVKERPASSEKVKGGDDHDDTSDSDSDGLTLKELQNRLRRKREQEPTERPLKGIQSRLRKKRREEGPAETVGSEASDTVEGVLPSKQEPENDQGVVSQAGKDDRESKLEGKAAQDIKDEEPGDLGRPKPECEGYDPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQDETHSETADQQEAKWRPGDADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILKHAAATMKFLSSGKEQKPKPKEKMKMKPEKPSLPKCGAQAGIKISSVHKRPAPEKKETTVKKAVVVPARSEALGKEAACESSTPSWASDHNYNAVKPEKTAAPSPSLLYKSTKEDRRSEEKAAAMAASKKTAPPGSAVGKQPAPRNLVPKKSSFANVAAATPAIKKPPSGFKGTIPKRPWLSATPSSGASAARQAGPAPAAATAASKKFPGSAALVGAVRKPVVPSVPMASPAPGRLGAMSAAPSQPNSQIRQNIRRSLKEILWKRVNDSDDLIMTENEVGKIALHIEKEMFNLFQVTDNRYKSKYRSIMFNLKDPKNQGLFHRVLREEISLAKLVRLKPEELVSKELSTWKERPARSVMESRTKLHNESKKTAPRQEAIPDLEDSPPVSDSEEQQESARAVPEKSTAPLLDVFSSMLKDTTSQHRAHLFDLNCKICTGQVPSAEDEPAPKKQKLSASVKKEDLKSKHDSSAPDPAPDSADEVMPEAVPEVASEPGLESASHPNVDRTYFPGPPGDGHPEPSPLEDLSPCPASCGSGVVTTVTVSGRDPRTAPSSSCTAVASAASRPDSTHMVEARQDVPKPVLTSVMVPKSILAKPSSSPDPRYLSVPPSPNISTSESRSPPEGDTTLFLSRLSTIWKGFINMQSVAKFVTKAYPVSGCFDYLSEDLPDTIHIGGRIAPKTVWDYVGKLKSSVSKELCLIRFHPATEEEEVAYISLYSYFSSRGRFGVVANNNRHVKDLYLIPLSAQDPVPSKLLPFEGPGLESPRPNIILGLVICQKIKRPANSGELDKMDEKRTRLQPEEADVPAYPKVATVPQSEKKPSKYPLCSADAAVSTTPPGSPPPPPPLPEPPVLKVLSSLKPAAPSPATAATTAAAASTAASSTASSASKTASPLEHILQTLFGKKKSFDPSAREPPGSTAGLPQEPKTTAEDGVPAPPLLDPIVQQFGQFSKDKALEEEEDDRPYDPEEEYDPERAFDTQLVERGRRHEVERAPEAAAAEREEVAYDPEDETILEEAKVTVDDLPNRMCADVRRNSVERPAEPVAGAATPSLVEQQKMLEELNKQIEEQKRQLEEQEEALRQQRAAVGVSMAHFSVSDALMSPPPKSSLPKAELFQQEQQSADKPASLPPASQASNHRDPRQARRLATETGEGEGEPLSRLSARGAQGALPERDASRGGLVGQAPMPVPEEKEPASSPWASGEKPPAGSEQDGWKAEPGEGTRPATVGDSSARPARRVLLPTPPCGALQPGFPLQHDGERDPFTCPGFASQDKALGSAQYEDPRNLHSAGRSSSPAGETEGDREPQARPGEGTAPLPPPGQKVGGSQPPFQGQREPGPHALGMSGLHGPNFPGPRGPAPPFPEENIASNDGPRGPPPARFGAQKGPIPSLFSGQHGPPPYGDSRGPSPSYLGGPRGVAPSQFEERKDPHGEKREFQDAPYNEVTGAPAQFEGTEQAPFLGSRGGAPFQFGGQRRPLLSQLKGPRGGPPPSQFGGQRGPPPGHFVGPRGPHPSQFETARGPHPNQFEGPRGQAPNFMPGPRGIQPQQFEDQRVHSPPRFTNQRAPAPLQFGGLRGSAPFSEKNEQTPSRFHFQGQAPQVMKPGPRPLLELPSHPPQHRKDRWEEAGPPSALSSSAPGQGPEADGQWASADFREGKGHEYRNQTFEGRQRERFDVGPKEKPLEEPDAQGRASEDRRRERERGRNWSRERDWDRPREWDRHRDKDSSRDWDRNRERSANRDREREADRGKEWDRSRERSRNRERERDRRRDRDRSRSRERDRDKARDRERGRDRKDRSKSKESARDPKPEASRASDAGTASQA 9B89361A24A72C58 numa1_human Nuclear mitotic apparatus protein 1 SP-H antigen NUMA1 NUMA NMP22 Nuclear matrix protein-22 Nuclear mitotic apparatus protein protein protein human Homo sapiens Human MTLHATRGAALLSWVNSLHVADPVEAVLQLQDCSIFIKIIDRIHGTEEGQQILKQPVSERLDFVCSFLQKNRKHPSSPECLVSAQKVLEGSELELAKMTMLLLYHSTMSSKSPRDWEQFEYKIQAELAVILKFVLDHEDGLNLNEDLENFLQKAPVPSTCSSTFPEELSPPSHQAKREIRFLELQKVASSSSGNNFLSGSPASPMGDILQTPQFQMRRLKKQLADERSNRDELELELAENRKLLTEKDAQIAMMQQRIDRLALLNEKQAASPLEPKELEELRDKNESLTMRLHETLKQCQDLKTEKSQMDRKINQLSEENGDLSFKLREFASHLQQLQDALNELTEEHSKATQEWLEKQAQLEKELSAALQDKKCLEEKNEILQGKLSQLEEHLSQLQDNPPQEKGEVLGDVLQLETLKQEAATLAANNTQLQARVEMLETERGQQEAKLLAERGHFEEEKQQLSSLITDLQSSISNLSQAKEELEQASQAHGARLTAQVASLTSELTTLNATIQQQDQELAGLKQQAKEKQAQLAQTLQQQEQASQGLRHQVEQLSSSLKQKEQQLKEVAEKQEATRQDHAQQLATAAEEREASLRERDAALKQLEALEKEKAAKLEILQQQLQVANEARDSAQTSVTQAQREKAELSRKVEELQACVETARQEQHEAQAQVAELELQLRSEQQKATEKERVAQEKDQLQEQLQALKESLKVTKGSLEEEKRRAADALEEQQRCISELKAETRSLVEQHKRERKELEEERAGRKGLEARLQQLGEAHQAETEVLRRELAEAMAAQHTAESECEQLVKEVAAWRERYEDSQQEEAQYGAMFQEQLMTLKEECEKARQELQEAKEKVAGIESHSELQISRQQNELAELHANLARALQQVQEKEVRAQKLADDLSTLQEKMAATSKEVARLETLVRKAGEQQETASRELVKEPARAGDRQPEWLEEQQGRQFCSTQAALQAMEREAEQMGNELERLRAALMESQGQQQEERGQQEREVARLTQERGRAQADLALEKAARAELEMRLQNALNEQRVEFATLQEALAHALTEKEGKDQELAKLRGLEAAQIKELEELRQTVKQLKEQLAKKEKEHASGSGAQSEAAGRTEPTGPKLEALRAEVSKLEQQCQKQQEQADSLERSLEAERASRAERDSALETLQGQLEEKAQELGHSQSALASAQRELAAFRTKVQDHSKAEDEWKAQVARGRQEAERKNSLISSLEEEVSILNRQVLEKEGESKELKRLVMAESEKSQKLEERLRLLQAETASNSARAAERSSALREEVQSLREEAEKQRVASENLRQELTSQAERAEELGQELKAWQEKFFQKEQALSTLQLEHTSTQALVSELLPAKHLCQQLQAEQAAAEKRHREELEQSKQAAGGLRAELLRAQRELGELIPLRQKVAEQERTAQQLRAEKASYAEQLSMLKKAHGLLAEENRGLGERANLGRQFLEVELDQAREKYVQELAAVRADAETRLAEVQREAQSTARELEVMTAKYEGAKVKVLEERQRFQEERQKLTAQVEQLEVFQREQTKQVEELSKKLADSDQASKVQQQKLKAVQAQGGESQQEAQRLQAQLNELQAQLSQKEQAAEHYKLQMEKAKTHYDAKKQQNQELQEQLRSLEQLQKENKELRAEAERLGHELQQAGLKTKEAEQTCRHLTAQVRSLEAQVAHADQQLRDLGKFQVATDALKSREPQAKPQLDLSIDSLDLSCEEGTPLSITSKLPRTQPDGTSVPGEPASPISQRLPPKVESLESLYFTPIPARSQAPLESSLDSLGDVFLDSGRKTRSARRRTTQIINITMTKKLDVEEPDSANSSFYSTRSAPASQASLRATSSTQSLARLGSPDYGNSALLSLPGYRPTTRSSARRSQAGVSSGAPPGRNSFYMGTCQDEPEQLDDWNRIAELQQRNRVCPPHLKTCYPLESRPSLSLGTITDEEMKTGDPQETLRRASMQPIQIAEGTGITTRQQRKRVSLEPHQGPGTPESKKATSCFPRPMTPRDRHEGRKQSTTEAQKKAAPASTKQADRRQSMAFSILNTPKKLGNSLLRRGASKKALSKASPNTRSGTRRSPRIATTTASAATAAAIGATPRAKGKAKH DIP protein Q14980 original sequence version: 132 DIP protein Q14980-1 original sequence version: 97 DE734EC85B812CC7 3bp2_mouse SH3 domain-binding protein 2 Sh3bp2 3bp2 protein protein mouse Mus musculus Mouse MAAEEMQWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLKWPLRFVIIHKRCIYYFKSSTSASPQGAFSLSGYNRVMRAAEETTSNNVFPFKIIHISKKHRTWFFSASSEDERKSWMAFVRREIGHFHEKKELPLDTSDSSSDTDSFYGAVERPIDISLSSYPMDNEDYEHEDEDDSYLEPDSPGPMKLEDALTYPPAYPPPPVPVPRKPAFSDLPRAHSFTSKSPSPLLPPPPPKRGLPDTGSAPEDAKDALGLRRVEPGLRVPATPRRMSDPPMSNVPTVPNLRKHPCFRDSVNPGLEPWTPGHGTSSVSSSTTMAVATSRNCDKLKSFHLSSRGPPTSEPPPVPANKPKFLKIAEEPSPREAAKFAPVPPVAPRPPVQKMPMPEATVRPAVLPRPENTPLPHLQRSPPDGQSFRGFSFEKARQPSQADTGEEDSDEDYEKVPLPNSVFVNTTESCEVERLFKATDPRGEPQDGLYCIRNSSTKSGKVLVVWDESSNKVRNYRIFEKDSKFYLEGEVLFASVGSMVEHYHTHVLPSHQSLLLRHPYGYAGPR EDFE1F11B259646E hxb2_human Homeobox protein Hox-B2 HOXB2 HOX2H Homeobox protein Hox-2.8 Homeobox protein Hox-2H K8 protein protein human Homo sapiens Human MNFEFEREIGFINSQPSLAECLTSFPAVLETFQTSSIKESTLIPPPPPFEQTFPSLQPGASTLQRPRSQKRAEDGPALPPPPPPPLPAAPPAPEFPWMKEKKSAKKPSQSATSPSPAASAVPASGVGSPADGLGLPEAGGGGARRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQHREPPDGEPACPGALEDICDPAEEPAASPGGPSASRAAWEACCHPPEVVPGALSADPRPLAVRLEGAGASSPGCALRGAGGLEPGPLPEDVFSGRQDSPFLPDLNFFAADSCLQLSGGLSPSLQGSLDSPVPFSEEELDFFTSTLCAIDLQFP D7ACA0E3D5BEBFB9 tb182_human 182 kDa tankyrase-1-binding protein TNKS1BP1 KIAA1741 TAB182 protein protein human Homo sapiens Human MKVSTLRESSAMASPLPREMEEELVPTGSEPGDTRAKPPVKPKPRALPAKPALPAKPSLLVPVGPRPPRGPLAELPSARKMNMLAGPQPYGGSKRPLPFAPRPAVEASTGGEATQETGKEEAGKEEPPPLTPPARCAAPGGVRKAPAPFRPASERFAATTVEEILAKMEQPRKEVLASPDRLWGSRLTFNHDGSSRYGPRTYGTTTAPRDEDGSTLFRGWSQEGPVKSPAECREEHSKTPEERSLPSDLAFNGDLAKAASSELPADISKPWIPSSPAPSSENGGPASPGLPAEASGSGPGSPHLHPPDKSSPCHSQLLEAQTPEASQASPCPAVTPSAPSAALPDEGSRHTPSPGLPAEGAPEAPRPSSPPPEVLEPHSLDQPPATSPRPLIEVGELLDLTRTFPSGGEEEAKGDAHLRPTSLVQRRFSEGVLQSPSQDQEKLGGSLAALPQGQGSQLALDRPFGAESNWSLSQSFEWTFPTRPSGLGVWRLDSPPPSPITEASEAAEAAEAGNLAVSSREEGVSQQGQGAGSAPSGSGSSWVQGDDPSMSLTQKGDGESQPQFPAVPLEPLPTTEGTPGLPLQQAEERYESQEPLAGQESPLPLATREAALPILEPVLGQEQPAAPDQPCVLFADAPEPGQALPVEEEAVTLARAETTQARTEAQDLCRASPEPPGPESSSRWLDDLLASPPPSGGGARRGAGAELKDTQSPSTCSEGLLGWSQKDLQSEFGITGDPQPSSFSPSSWCQGASQDYGLGGASPRGDPGLGERDWTSKYGQGAGEGSTREWASRCGIGQEEMEASSSQDQSKVSAPGVLTAQDRVVGKPAQLGTQRSQEADVQDWEFRKRDSQGTYSSRDAELQDQEFGKRDSLGTYSSRDVSLGDWEFGKRDSLGAYASQDANEQGQDLGKRDHHGRYSSQDADEQDWEFQKRDVSLGTYGSRAAEPQEQEFGKSAWIRDYSSGGSSRTLDAQDRSFGTRPLSSGFSPEEAQQQDEEFEKKIPSVEDSLGEGSRDAGRPGERGSGGLFSPSTAHVPDGALGQRDQSSWQNSDASQEVGGHQERQQAGAQGPGSADLEDGEMGKRGWVGEFSLSVGPQREAAFSPGQQDWSRDFCIEASERSYQFGIIGNDRVSGAGFSPSSKMEGGHFVPPGKTTAGSVDWTDQLGLRNLEVSSCVGSGGSSEARESAVGQMGWSGGLSLRDMNLTGCLESGGSEEPGGIGVGEKDWTSDVNVKSKDLAEVGEGGGHSQARESGVGQTDWSGVEAGEFLKSRERGVGQADWTPDLGLRNMAPGAVCSPGESKELGVGQMDWGNNLGLRDLEVTCDPDSGGSQGLRGCGVGQMDWTQDLAPQNVELFGAPSEAREHGVGGVSQCPEPGLRHNGSLSPGLEARDPLEARELGVGETSGPETQGEDYSSSSLEPHPADPGMETGEALSFGASPGRCPARPPPSGSQGLLEEMLAASSSKAVARRESAASGLGGLLEEEGAGAGAAQEEVLEPGRDSPPSWRPQPDGEASQTEDVDGTWGSSAARWSDQGPAQTSRRPSQGPPARSPSQDFSFIEDTEILDSAMYRSRANLGRKRGHRAPVIRPGGTLGLSEAADSDAHLFQDSTEPRASRVPSSDEEVVEEPQSRRTRMSLGTKGLKVNLFPGLSPSALKAKLRPRNRSAEEGELAESKSSQKESAVQRSKSCKVPGLGKPLTLPPKPEKSSGSEGSSPNWLQALKLKKKKV 561FA5C27C923036 pp12c_human Protein phosphatase 1 regulatory subunit 12C LENG3 MBS85 Protein phosphatase 1 myosin-binding subunit of 85 kDa PPP1R12C protein protein human Homo sapiens Human MSGEDGPAAGPGAAAAAARERRREQLRQWGARAGAEPGPGERRARTVRFERAAEFLAACAGGDLDEARLMLRAADPGPGAELDPAAPPPARAVLDSTNADGISALHQACIDENLEVVRFLVEQGATVNQADNEGWTPLHVAASCGYLDIARYLLSHGANIAAVNSDGDLPLDLAESDAMEGLLKAEIARRGVDVEAAKRAEEELLLHDTRCWLNGGAMPEARHPRTGASALHVAAAKGYIEVMRLLLQAGYDPELRDGDGWTPLHAAAHWGVEDACRLLAEHGGGMDSLTHAGQRPCDLADEEVLSLLEELARKQEDLRNQKEASQSRGQEPQAPSSSKHRRSSVCRLSSREKISLQDLSKERRPGGAGGPPIQDEDEGEEGPTEPPPAEPRTLNGVSSPPHPSPKSPVQLEEAPFSRRFGLLKTGSSGALGPPERRTAEGAPGAGLQRSASSSWLEGTSTQAKELRLARITPTPSPKLPEPSVLSEVTKPPPCLENSSPPSRIPEPESPAKPNVPTASTAPPADSRDRRRSYQMPVRDEESESQRKARSRLMRQSRRSTQGVTLTDLKEAEKAAGKAPESEKPAQSLDPSRRPRVPGVENSDSPAQRAEAPDGQGPGPQAAREHRKVGKEWRGPAEGEEAEPADRSQESSTLEGGPSARRQRWQRDLNPEPEPESEEPDGGFRTLYAELRRENERLREALTETTLRLAQLKVELERATQRQERFAERPALLELERFERRALERKAAELEEELKALSDLRADNQRLKDENAALIRVISKLSK 677E7EB1B62C2CC8 strn_mouse Striatin Strn protein protein mouse Mus musculus Mouse MDEQAGPGVFFSNNHPGAGGAKGLGPLAEAAAAGDGAAAAGAARAQYSLPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLKYGTELNQGDMKPPSYDSDEGNETEVQPQQNSQLMWKQGRQLLRQYLQEVGYTDTILDVKSKRVRALLGFSSDVTDREDDKNQDSVINGTEAEVKETAMIGKSELTDSASVLDNFKFLESAAADVSDEDEDEDTDGRAKSVIDTSTIVRKKALPDTSEDRDTKEALKEFDFLVTSEEGDNESRSAGDGTDWEKEDQCLTPEAWNVDQGVISKLKEQYKKERKGKKGVKRPNRSKLQDMLANLRDVDELPSLQPSVGSPSRPSSSRLPEQELSRADEVEALTFPPSSGKSFIMGADEALESELGLGELAGLTVANEADSLAYDIANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAKKSTSLDVEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGRIQSWSTTNPNVDPYDAYDPSVLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWNTTEVAPALSVFNDNQELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRVLTLESNVDSTSSSSCQINRVISHPTLPISITAHEDRHIKFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV DC1C1D98E9E5BC08 fnbp1_human Formin-binding protein 1 FNBP1 FBP17 Formin-binding protein 17 KIAA0554 protein protein human Homo sapiens Human MSWGTELWDQFDNLEKHTQWGIDILEKYIKFVKERTEIELSYAKQLRNLSKKYQPKKNSKEEEEYKYTSCKAFISNLNEMNDYAGQHEVISENMASQIIVDLARYVQELKQERKSNFHDGRKAQQHIETCWKQLESSKRRFERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQIRHQMAEDSKADYSSILQKFNHEQHEYYHTHIPNIFQKIQEMEERRIVRMGESMKTYAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVIEAYKSGFEPPGDIEFEDYTQPMKRTVSDNSLSNSRGEGKPDLKFGGKSKGKLWPFIKKNKLMSLLTSPHQPPPPPPASASPSAVPNGPQSPKQQKEPLSHRFNEFMTSKPKIHCFRSLKRGLSLKLGATPEDFSNLPPEQRRKKLQQKVDELNKEIQKEMDQRDAITKMKDVYLKNPQMGDPASLDHKLAEVSQNIEKLRVETQKFEAWLAEVEGRLPARSEQARRQSGLYDSQNPPTVNNCAQDRESPDGSYTEEQSQESEMKVLATDFDDEFDDEEPLPAIGTCKALYTFEGQNEGTISVVEGETLYVIEEDKGDGWTRIRRNEDEEGYVPTSYVEVCLDKNAKDS DIP protein Q96RU3 original sequence version: 122 F06E847C6E631EC3 ce170_human Centrosomal protein of 170 kDa CEP170 FAM68A KAB KIAA0470 KARP-1-binding protein protein protein human Homo sapiens Human MSLTSWFLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYDASTDEHLVKDLGSLNGTFVNDVRIPEQTYITLKLEDKLRFGYDTNLFTVVQGEMRVPEEALKHEKFTIQLQLSQKSSESELSKSASAKSIDSKVADAATEVQHKTTEALKSEEKAMDISAMPRGTPLYGQPSWWGDDEVDEKRAFKTNGKPEEKNHEAGTSGCGIDAKQVEEQSAAANEEVLFPFCREPSYFEIPTKEFQQPSQITESTIHEIPTKDTPSSHITGAGHASFTIEFDDSTPGKVTIRDHVTKFTSDQRHKSKKSSPGTQDLLGIQTGMMAPENKVADWLAQNNPPQMLWERTEEDSKSIKSDVPVYLKRLKGNKHDDGTQSDSENAGAHRRCSKRATLEEHLRRHHSEHKKLQKVQATEKHQDQAVTSSAHHRGGHGVPHGKLLKQKSEEPSVSIPFLQTALLRSSGSLGHRPSQEMDKMLKNQATSATSEKDNDDDQSDKGTYTIELENPNSEEVEARKMIDKVFGVDDNQDYNRPVINEKHKDLIKDWALSSAAAVMEERKPLTTSGFHHSEEGTSSSGSKRWVSQWASLAANHTRHDQEERIMEFSAPLPLENETEISESGMTVRSTGSATSLASQGERRRRTLPQLPNEEKSLESHRAKVVTQRSEIGEKQDTELQEKETPTQVYQKDKQDADRPLSKMNRAVNGETLKTGGDNKTLLHLGSSAPGKEKSETDKETSLVKQTLAKLQQQEQREEAQWTPTKLSSKNVSGQTDKCREETFKQESQPPEKNSGHSTSKGDRVAQSESKRRKAEEILKSQTPKGGDKKESSKSLVRQGSFTIEKPSPNIPIELIPHINKQTSSTPSSLALTSASRIRERSESLDPDSSMDTTLILKDTEAVMAFLEAKLREDNKTDEGPDTPSYNRDNSISPESDVDTASTISLVTGETERKSTQKRKSFTSLYKDRCSTGSPSKDVTKSSSSGAREKMEKKTKSRSTDVGSRADGRKFVQSSGRIRQPSVDLTDDDQTSSVPHSAISDIMSSDQETYSCKPHGRTPLTSADEHVHSKLEGSKVTKSKTSPVVSGSSSKSTTLPRPRPTRTSLLRRARLGEASDSELADADKASVASEVSTTSSTSKPPTGRRNISRIDLLAQPRRTRLGSLSARSDSEATISRSSASSRTAEAIIRSGARLVPSDKFSPRIRANSISRLSDSKVKSMTSAHGSASVNSRWRRFPTDYASTSEDEFGSNRNSPKHTRLRTSPALKTTRLQSAGSAMPTSSSFKHRIKEQEDYIRDWTAHREEIARISQDLALIAREINDVAGEIDSVTSSGTAPSTTVSTAATTPGSAIDTREELVDRVFDESLNFRKIPPLVHSKTPEGNNGRSGDPRPQAAEPPDHLTITRRRTWSRDEVMGDNLLLSSVFQFSKKIRQSIDKTAGKIRILFKDKDRNWDDIESKLRAESEVPIVKTSSMEISSILQELKRVEKQLQAINAMIDPDGTLEALNNMGFPSAMLPSPPKQKSSPVNNHHSPGQTPTLGQPEARALHPAAVSAAAEFENAESEADFSIHFNRFNPDGEEEDVTVQE DIP protein Q5SW79 original sequence version: 53 DIP protein Q5SW79 original sequence version: 106 50E981650D21B2E6 rad54_human DNA repair and recombination protein RAD54-like RAD54L RAD54A RAD54 homolog protein protein human Homo sapiens Human MRRSLAPSQLAKRKPEGRSCDDEDWQPGLVTPRKRKSSSETQIQECFLSPFRKPLSQLTNQPPCLDSSQHEAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEKDALVLYEPPPLSAHDQLKLDKEKLPVHVVVDPILSKVLRPHQREGVKFLWECVTSRRIPGSHGCIMADEMGLGKTLQCITLMWTLLRQSPECKPEIDKAVVVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGARVSSPILIISYETFRLHVGVLQKGSVGLVICDEGHRLKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAHEFKKHFELPILKGRDAAASEADRQLGEERLRELTSIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQTELYKRFLRQAKPAEELLEGKMSVSSLSSITSLKKLCNHPALIYDKCVEEEDGFVGALDLFPPGYSSKALEPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLYVRLDGTMSIKKRAKVVERFNSPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPANDEQAMARVWRDGQKKTCYIYRLLSAGTIEEKIFQRQSHKKALSSCVVDEEQDVERHFSLGELKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVLQAAWDAASTAITFVFHQRSHEEQRGLR DIP protein Q92698 original sequence version: 82 718100974CA6687B taok2_human Serine/threonine-protein kinase TAO2 TAOK2 KIAA0881 MAP3K17 PSK PSK1 UNQ2971/PRO7431 Prostate-derived sterile 20-like kinase 1 Thousand and one amino acid protein kinase 2 Kinase from chicken homolog C protein protein human Homo sapiens Human MPAGGRAGSLKDPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHRDVKAGNILLSEPGLVKLGDFGSASIMAPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPLFNMNAMSALYHIAQNESPVLQSGHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDAVRELDNLQYRKMKKILFQEAPNGPGAEAPEEEEEAEPYMHRAGTLTSLESSHSVPSMSISASSQSSSVNSLADASDNEEEEEEEEEEEEEEEGPEAREMAMMQEGEHTVTSHSSIIHRLPGSDNLYDDPYQPEITPSPLQPPAAPAPTSTTSSARRRAYCRNRDHFATIRTASLVSRQIQEHEQDSALREQLSGYKRMRRQHQKQLLALESRLRGEREEHSARLQRELEAQRAGFGAEAEKLARRHQAIGEKEARAAQAEERKFQQHILGQQKKELAALLEAQKRTYKLRKEQLKEELQENPSTPKREKAEWLLRQKEQLQQCQAEEEAGLLRRQRQYFELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQKHAAQVRQQPKSLKVRAGQRPPGLPLPIPGALGPPNTGTPIEQQPCSPGQEAVLDQRMLGEEEEAVGERRILGKEGATLEPKQQRILGEESGAPSPSPQKHGSLVDEEVWGLPEEIEELRVPSLVPQERSIVGQEEAGTWSLWGKEDESLLDEEFELGWVQGPALTPVPEEEEEEEEGAPIGTPRDPGDGCPSPDIPPEPPPTHLRPCPASQLPGLLSHGLLAGLSFAVGSSSGLLPLLLLLLLPLLAAQGGGGLQAALLALEVGLVGLGASYLLLCTALHLPSSLFLLLAQGTALGAVLGLSWRRGLMGVPLGLGAAWLLAWPGLALPLVAMAAGGRWVRQQGPRVRRGISRLWLRVLLRLSPMAFRALQGCGAVGDRGLFALYPKTNKDGFRSRLPVPGPRRRNPRTTQHPLALLARVWVLCKGWNWRLARASQGLASHLPPWAIHTLASWGLLRGERPTRIPRLLPRSQRQLGPPASRQPLPGTLAGRRSRTRQSRALPPWR 211852E690934307 strn_human Striatin STRN protein protein human Homo sapiens Human MDEQAGPGVFFSNNHPGAGGAKGLGPLAEAAAAGDGAAAAGAARAQYSLPGILHFLQHEWARFEVERAQWEVERAELQAQIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLKYGTELNQGDMKPPSYDSDEGNETEVQPQQNSQLMWKQGRQLLRQYLQEVGYTDTILDVKSKRVRALLGFSSDVTDREDDKNQDSVVNGTEAEVKETAMIAKSELTDSASVLDNFKFLESAAADFSDEDEDDDVDGREKSVIDTSTIVRKKALPDSGEDRDTKEALKEFDFLVTSEEGDNESRSAGDGTDWEKEDQCLMPEAWNVDQGVITKLKEQYKKERKGKKGVKRPNRSKLQDMLANLRDVDELPSLQPSVGSPSRPSSSRLPEHEINRADEVEALTFPPSSGKSFIMGADEALESELGLGELAGLTVANEADSLTYDIANNKDALRKTWNPKFTLRSHFDGIRALAFHPIEPVLITASEDHTLKMWNLQKTAPAKKSTSLDVEPIYTFRAHKGPVLCVVMSSNGEQCYSGGTDGLIQGWNTTNPNIDPYDSYDPSVLRGPLLGHTDAVWGLAYSAAHQRLLSCSADGTLRLWNTTEVAPALSVFNDTKELGIPASVDLVSSDPSHMVASFSKGYTSIFNMETQQRILTLESNVDTTANSSCQINRVISHPTLPISITAHEDRHIKFYDNNTGKLIHSMVAHLEAVTSLAVDPNGLYLMSGSHDCSIRLWNLESKTCIQEFTAHRKKFEESIHDVAFHPSKCYIASAGADALAKVFV DDB18A11102BEA35 baba1_human BRISC and BRCA1-A complex member 1 BABAM1 HSPC142 C19orf62 NBA1 Mediator of RAP80 interactions and targeting subunit of 40 kDa New component of the BRCA1-A complex MERIT40 protein protein human Homo sapiens Human MEVAEPSSPTEEEEEEEEHSAEPRPRTRSNPEGAEDRAVGAQASVGSRSEGEGEAASADDGSLNTSGAGPKSWQVPPPAPEVQIRTPRVNCPEKVIICLDLSEEMSLPKLESFNGSKTNALNVSQKMIEMFVRTKHKIDKSHEFALVVVNDDTAWLSGLTSDPRELCSCLYDLETASCSTFNLEGLFSLIQQKTELPVTENVQTIPPPYVVRTILVYSRPPCQPQFSLTEPMKKMFQCPYFFFDVVYIHNGTEEKEEEMSWKDMFAFMGSLDTKGTSYKYEVALAGPALELHNCMAKLLAHPLQRPCQSHASYSLLEEEDEAIEVEATV 7A84D8EE6D03C1DB fat4_human Protocadherin Fat 4 CDHF14 FATJ FAT tumor suppressor homolog 4 Fat-like cadherin protein FAT-J Nbla00548 FAT4 Cadherin family member 14 protein protein human Homo sapiens Human MDLAPDRATGRPWLPLHTLSVSQLLRVFWLLSLLPGQAWVHGAEPRQVFQVLEEQPPGTLVGTIQTRPGFTYRLSESHALFAINSSTGALYTTSTIDRESLPSDVINLVVLSSAPTYPTEVRVLVRDLNDNAPVFPDPSIVVTFKEDSSSGRQVILDTATDSDIGSNGVDHRSYRIIRGNEAGRFRLDITLNPSGEGAFLHLVSKGGLDREVTPQYQLLVEVEDKGEPKRRGYLQVNVTVQDINDNPPVFGSSHYQAGVPEDAVVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQMDPETGLITVREPLDFEARRQYSLTVQAMDRGVPSLTGRAEALIQLLDVNDNDPVVKFRYFPATSRYASVDENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQSSKVPNLSLIKVASALDRERIPSYNLTVSVSDNYGAPPGAAVQARSSVASLVIFVNDINDHPPVFSQQVYRVNLSEEAPPGSYVSGISATDGDSGLNANLRYSIVSGNGLGWFHISEHSGLVTTGSSGGLDRELASQIVLNISARDQGVHPKVSYAQLVVTLLDVNDEKPVFSQPEGYDVSVVENAPTGTELLMLRATDGDLGDNGTVRFSLQEAETDRRSFRLDPVSGRLSTISSLDREEQAFYSLLVLATDLGSPPQSSMARINVSLLDINDNSPVFYPVQYFAHIKENEPGGSYITTVSATDPDLGTNGTVKYSISAGDRSRFQVNAQSGVISTRMALDREEKTAYQLQIVATDGGNLQSPNQAIVTITVLDTQDNPPVFSQVAYSFVVFENVALGYHVGSVSASTMDLNSNISYLITTGDQKGMFAINQVTGQLTTANVIDREEQSFYQLKVVASGGTVTGDTMVNITVKDLNDNSPHFLQAIESVNVVENWQAGHSIFQAKAVDPDEGVNGMVLYSLKQNPKNLFAINEKNGTISLLGPLDVHAGSYQIEILASDMGVPQLSSSVILTVYVHDVNDNSPVFDQLSYEVTLSESEPVNSRFFKVQASDKDSGANGEIAYTIAEGNTGDAFGIFPDGQLYIKSELDRELQDRYVLMVVASDRAVEPLSATVNVTVILEDVNDNRPLFNSTNYTFYFEEEQRAGSFVGKVSAVDKDFGPNGEVRYSFEMVQPDFELHAISGEITNTHQFDRESLMRRRGTAVFSFTVIATDQGIPQPLKDQATVHVYMKDINDNAPKFLKDFYQATISESAANLTQVLRVSASDVDEGNNGLIHYSIIKGNEERQFAIDSTSGQVTLIGKLDYEATPAYSLVIQAVDSGTIPLNSTCTLNIDILDENDNTPSFPKSTLFVDVLENMRIGELVSSVTATDSDSGDNADLYYSITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKLNITAKDQGRPPRSSTMSVVIHVRDFNDNPPSFPPGDIFKSIVENIPIGTSVISVTAHDPDADINGQLSYTIIQQMPRGNHFTIDEVKGTIYTNAEIDREFANLFELTVKANDQAVPIETRRYALKNVTILVTDLNDNVPMFISQNALAADPSAVIGSVLTTIMAADPDEGANGEIEYEIINGDTDTFIVDRYSGDLRVASALVPSQLIYNLIVSATDLGPERRKSTTELTIILQGLDGPVFTQPKYITILKEGEPIGTNVISIEAASPRGSEAPVEYYIVSVRCEEKTVGRLFTIGRHTGIIQTAAILDREQGACLYLVDVYAIEKSTAFPRTQRAEVEITLQDINDNPPVFPTDMLDLTVEENIGDGSKIMQLTAMDADEGANALVTYTIISGADDSFRIDPESGDLIATRRLDRERRSKYSLLVRADDGLQSSDMRINITVSDVNDHTPKFSRPVYSFDIPEDTIPGSLVAAILATDDDSGVNGEITYIVNEDDEDGIFFLNPITGVFNLTRLLDYEVQQYYILTVRAEDGGGQFTTIRVYFNILDVNDNPPIFSLNSYSTSLMENLPVGSTVLVFNVTDADDGINSQLTYSIASGDSLGQFTVDKNGVLKVLKALDRESQSFYNLVVQVHDLPQIPASRFTSTAQVSIILLDVNDNPPTFLSPKLTYIPENTPIDTVVFKAQATDPDSGPNSYIEYTLLNPLGNKFSIGTIDGEVRLTGELDREEVSNYTLTVVATDKGQPSLSSSTEVVVMVLDINDNNPIFAQALYKVEINENTLTGTDIIQVFAADGDEGTNGQVRYGIVNGNTNQEFRIDSVTGAITVAKPLDREKTPTYHLTVQATDRGSTPRTDTSTVSIVLLDINDFVPVFELSPYSVNVPENLGTLPRTILQVVARDDDRGSNSKLSYVLFGGNEDNAFTLSASGELGVTQSLDRETKERFVLMITATDSGSPALTGTGTINVIVDDVNDNVPTFASKAYFTTIPEDAPTGTDVLLVNASDADASKNAVIRIIGGNSQFTINPSTGQIITSALLDRETKDNYTLVVVCSDAGSPEPLSSSTSVLVTVTDVNDNPPRFQHHPYVTHIPSPTLPGSFVFAVTVTDADIGPNSELHYSLSGRNSEKFHIDPLRGAIMAAGPLNGASEVTFSVHVKDGGSFPKTDSTTVTVRFVNKADFPKVRAKEQTFMFPENQPVSSLVTTITGSSLRGEPMSYYIASGNLGNTFQIDQLTGQVSISQPLDFEKIQKYVVWIEARDGGFPPFSSYEKLDITVLDVNDNAPIFKEDPFISEILENLSPRKILTVSAMDKDSGPNGQLDYEIVNGNMENSFSINHATGEIRSVRPLDREKVSHYVLTIKSSDKGSPSQSTSVKVMINILDENDNAPRFSQIFSAHVPENSPLGYTVTRVTTSDEDIGINAISRYSIMDASLPFTINPSTGDIVISRPLNREDTDRYRIRVSAHDSGWTVSTDVTIFVTDINDNAPRFSRTSYYLDCPELTEIGSKVTQVFATDPDEGSNGQVFYFIKSQSEYFRINATTGEIFNKQILKYQNVTGFSNVNINRHSFIVTSSDRGKPSLISETTVTINIVDSNDNAPQFLKSKYFTPVTKNVKVGTKLIRVTAIDDKDFGLNSEVEYFISNDNHLGKFKLDNDTGWISVASSLISDLNQNFFITVTAKDKGNPPLSSQATVHITVTEENYHTPEFSQSHMSATIPESHSIGSIVRTVSARDRDAAMNGLIKYSISSGNEEGIFAINSSTGILTLAKALDYELCQKHEMTISAIDGGWVARTGYCSVTVNVIDVNDNSPVFLSDDYFPTVLENAPSGTTVIHLNATDADSGTNAVIAYTVQSSDSDLFVIDPNTGVITTQGFLDFETKQSYHLTVKAFNVPDEERCSFATVNIQLKGTNEYVPRFVSKLYYFEISEAAPKGTIVGEVFASDRDLGTDGEVHYLIFGNSRKKGFQINKKTGQIYVSGILDREKEERVSLKVLAKNFGSIRGADIDEVTVNVTVLDANDPPIFTLNIYSVQISEGVPIGTHVTFVSAFDSDSIPSWSRFSYFIGSGNENGAFSINPQTGQITVTAELDRETLPIYNLSVLAVDSGTPSATGSASLLVTLEDINDNGPMLTVSEGEVMENKRPGTLVMTLQSTDPDLPPNQGPFTYYLLSTGPATSYFSLSTAGVLSTTREIDREQIADFYLSVVTKDSGVPQMSSTGTVHITVIDQNDNPSQSRTVEIFVNYYGNLFPGGILGSVKPQDPDVLDSFHCSLTSGVTSLFSIPGGTCDLNSQPRSTDGTFDLTVLSNDGVHSTVTSNIRVFFAGFSNATVDNSILLRLGVPTVKDFLTNHYLHFLRIASSQLTGLGTAVQLYSAYEENNRTFLLAAVKRNHNQYVNPSGVATFFESIKEILLRQSGVKVESVDHDSCVHGPCQNGGSCLRRLAVSSVLKSRESLPVIIVANEPLQPFLCKCLPGYAGSWCEIDIDECLPSPCHSGGTCHNLVGGFSCSCPDGFTGRACERDINECLQSPCKNGAICQNFPGSFNCVCKTGYTGKMCESSVNYCECNPCFNGGSCQSGVDSYYCHCPFGVFGKHCELNSYGFEELSYMEFPSLDPNNNYIYVKFATIKSHALLLYNYDNQTGDRAEFLALEIAEERLRFSYNLGSGTYKLTTMKKVSDGHFHTVIARRAGMAASLTVDSCSENQEPGYCTVSNVAVSDDWTLDVQPNRVTVGGIRSLEPILQRRGHVESHDFVGCIMEFAVNGRPLEPSQALAAQGILDQCPRLEGACTRSPCQHGGTCMDYWSWQQCHCKEGLTGKYCEKSVTPDTALSLEGKGRLDYHMSQNEKREYLLRQSLRGAMLEPFGVNSLEVKFRTRSENGVLIHIQESSNYTTVKIKNGKVYFTSDAGIAGKVERNIPEVYVADGHWHTFLIGKNGTATVLSVDRIYNRDIIHPTQDFGGLDVLTISLGGIPPNQAHRDAQTAGFDGCIASMWYGGESLPFSGKHSLASISKTDPSVKIGCRGPNICASNPCWGDLLCINQWYAYRCVPPGDCASHPCQNGGSCEPGLHSGFTCSCPDSHTGRTCEMVVACLGVLCPQGKVCKAGSPAGHVCVLSQGPEEISLPLWAVPAIVGSCATVLALLVLSLILCNQCRGKKAKNPKEEKKPKEKKKKGSENVAFDDPDNIPPYGDDMTVRKQPEGNPKPDIIERENPYLIYDETDIPHNSETIPSAPLASPEQEIEHYDIDNASSIAPSDADIIQHYKQFRSHTPKFSIQRHSPLGFARQSPMPLGASSLTYQPSYGQGLRTSSLSHSACPTPNPLSRHSPAPFSKSSTFYRNSPARELHLPIRDGNTLEMHGDTCQPGIFNYATRLGRRSKSPQAMASHGSRPGSRLKQPIGQIPLESSPPVGLSIEEVERLNTPRPRNPSICSADHGRSSSEEDCRRPLSRTRNPADGIPAPESSSDSDSHESFTCSEMEYDREKPMVYTSRMPKLSQVNESDADDEDNYGARLKPRRYHGRRAEGGPVGTQAAAPGTADNTLPMKLGQQAGTFNWDNLLNWGPGFGHYVDVFKDLASLPEKAAANEEGKAGTTKPVPKDGEAEQYV 588ED3CC4612A6DA fastk_human Fas-activated serine/threonine kinase FASTK protein protein human Homo sapiens Human MRRPRGEPGPRAPRPTEGATCAGPGESWSPSPNSMLRVLLSAQTSPARLSGLLLIPPVQPCCLGPSKWGDRPVGGGPSAGPVQGLQRLLEQAKSPGELLRWLGQNPSKVRAHHYSVALRRLGQLLGSRPRPPPVEQVTLQDLSQLIIRNCPSFDIHTIHVCLHLAVLLGFPSDGPLVCALEQERRLRLPPKPPPPLQPLLRGGQGLEAALSCPRFLRYPRQHLISSLAEARPEELTPHVMVLLAQHLARHRLREPQLLEAIAHFLVVQETQLSSKVVQKLVLPFGRLNYLPLEQQFMPCLERILAREAGVAPLATVNILMSLCQLRCLPFRALHFVFSPGFINYISGTPHALIVRRYLSLLDTAVELELPGYRGPRLPRRQQVPIFPQPLITDRARCKYSHKDIVAEGLRQLLGEEKYRQDLTVPPGYCTDFLLCASSSGAVLPVRTQDPFLPYPPRSCPQGQAASSATTRDPAQRVVLVLRERWHFCRDGRVLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQKLQALGLRWGPEGG 76D38A211B37304A terf1_human Telomeric repeat-binding factor 1 TTAGGG repeat-binding factor 1 NIMA-interacting protein 2 Telomeric protein Pin2/TRF1 TERF1 PIN2 TRF TRF1 TRBF1 protein protein human Homo sapiens Human MAEDVSSAAPSPRGCADGRDADPTEEQMAETERNDEEQFECQELLECQVQVGAPEEEEEEEEDAGLVAEAEAVAAGWMLDFLCLSLCRAFRDGRSEDFRRTRNSAEAIIHGLSSLTACQLRTIYICQFLTRIAAGKTLDAQFENDERITPLESALMIWGSIEKEHDKLHEEIQNLIKIQAIAVCMENGNFKEAEEVFERIFGDPNSHMPFKSKLLMIISQKDTFHSFFQHFSYNHMMEKIKSYVNYVLSEKSSTFLMKAAAKVVESKRTRTITSQDKPSGNDVEMETEANLDTRKSVSDKQSAVTESSEGTVSLLRSHKNLFLSKLQHGTQQQDLNKKERRVGTPQSTKKKKESRRATESRIPVSKSQPVTPEKHRARKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLKLISSDSED DIP protein P54274 original sequence version: 121 DIP protein P54274-1 original sequence version: 81 DIP protein P54274 original sequence version: 168 AB548E7D3124A211 my18b_human Unconventional myosin-XVIIIb MYO18B protein protein human Homo sapiens Human MAISSRLALWEQKIREEDKSPPPSSPPPLFSVIPGGFIKQLVRGTEKEAKEARQRKQLAVASPEREIPEISISQPNSKSSSGTRSGSQQISQDDQSSSPGSSDILGKESEGSRSPDPEQMTSINGEKAQELGSSATPTKKTVPFKRGVRRGDVLLMVAKLDPDSAKPEKTHPHDAPPCKTSPPATDTGKEKKGETSRTPCGSQASTEILAPKAEKTRTGGLGDPGQGTVALKKGEEGQSIVGKGLGTPKTTELKEAEPQGKDRQGTRPQAQGPGEGVRPGKAEKEGAEPTNTVEKGNVSKDVGSEGKHVRPQIPGRKWGGFLGRRSKWDGPQNKKDKEGVLLSKAEKTGEPQTQMEKTSQVQGELGDDLRMGEKAGELRSTTGKAGESWDKKEKMGQPQGKSGNAGEARSQTEKGCEAPKEVSTMVESPAAPGKGGWPGSRGQEAEEPCSRAGDGAGALETELEGPSQPALEKDAERPRIRKENQDGPAPQEEGKGGQSRDSDQAPEDRWYEAEKVWLAQKDGFTLATVLKPDEGTADLPAGRVRLWIDADKTITEVDEEHVHRANPPELDQVEDLASLISVNESSVLNTLLQRYKAQLLHTCTGPDLIVLQPRGPSVPSAGKVPKGRRDGLPAHIGSMAQRAYWALLNQRRDQSIVALGWSGAGKTTCCEQVLEHLVGMAGSVDGRVSVEKIRATFTVLRAFGSVSMAHSRSATRFSMVMSLDFNATGRITAAQLQTMLLEKSRVARQPEGESNFLVFSQMLAGLDLDLRTELNLHQMADSSSFGMGVWSKPEDKQKAAAAFAQLQGAMEMLGISESEQRAVWRVLAAIYHLGAAGACKVGRKQFMRFEWANYAAEALGCEYEELNTATFKHHLRQIIQQMTFGPSRWGLEDEETSSGLKMTGVDCVEGMASGLYQELFAAVVSLINRSFSSHHLSMASIMVVDSPGFQNPRHQGKDRAATFEELCHNYAHERLQLLFYQRTFVSTLQRYQEEGVPVQFDLPDPSPGTTVAVVDQNPSQVRLPAGGGAQDARGLFWVLDEEVHVEGSSDSVVLERLCAAFEKKGAGTEGSSALRTCEQPLQCEIFHQLGWDPVRYDLTGWLHRAKPNLSALDAPQVLHQSKREELRSLFQARAKLPPVCRAVAGLEGTSQQALQRSRMVRRTFASSLAAVRRKAPCSQIKLQMDALTSMIKRSRLHFIHCLVPNPVVESRSGQESPPPPQPGRDKPGAGGPLALDIPALRVQLAGFHILEALRLHRTGYADHMGLTRFRRQFQVLDAPLLKKLMSTSEGIDERKAVEELLETLDLEKKAVAVGHSQVFLKAGVISRLEKQREKLVSQSIVLFQAACKGFLSRQEFKKLKIRRLAAQCIQKNVAVFLAVKDWPWWQLLGSLQPLLSATIGTEQLRAKEEELTTLRRKLEKSEKLRNELRQNTDLLESKIADLTSDLADERFKGDVACQVLESERAERLQAFREVQELKSKHEQVQKKLGDVNKQLEEAQQKIQLNDLERNPTGGADEWQMRFDCAQMENEFLRKRLQQCEERLDSELTARKELEQKLGELQSAYDGAKKMAHQLKRKCHHLTCDLEDTCVLLENQQSRNHELEKKQKKFDLQLAQALGESVFEKGLREKVTQENTSVRWELGQLQQQLKQKEQEASQLKQQVEMLQDHKRELLGSPSLGENCVAGLKERLWKLESSALEQQKIQSQQENTIKQLEQLRQRFELEIERMKQMHQKDREDQEEELEDVRQSCQKRLHQLEMQLEQEYEEKQMVLHEKQDLEGLIGTLCDQIGHRDFDVEKRLRRDLRRTHALLSDVQLLLGTMEDGKTSVSKEELEKVHSQLEQSEAKCEEALKTQKVLTADLESMHSELENMTRNKSLVDEQLYRLQFEKADLLKRIDEDQDDLNELMQKHKDLIAQSAADIGQIQELQLQLEEAKKEKHKLQEQLQVAQMRIEYLEQSTVDRAIVSRQEAVICDLENKTEFQKVQIKRFEVLVIRLRDSLIKMGEELSQAATSESQQRESSQYYQRRLEELKADMEELVQREAEASRRCMELEKYVEELAAVRQTLQTDLETSIRRIADLQAALEEVASSDSDTESVQTAVDCGSSGRKEMDNVSILSSQPEGSLQSWLSCTLSLATDTMRTPSRQSATSSRILSPRINEEAGDTERTQSALALSRARSTNVHSKTSGDKPVSPHFVRRQKYCHFGDGEVLAVQRKSTERLEPASSPLASRSTNTSPLSREKLPSPSAALSEFVEGLRRKRAQRGQGSTLGLEDWPTLPIYQTTGASTLRRGRAGSDEGNLSLRVGAKSPLEIEGAAGGLLRSTSLKCISSDGVGGTTLLPEKSKTQFSSCESLLESRPSMGRKLSSPTTPRDMLLSPTLRPRRRCLESSVDDAGCPDLGKEPLVFQNRQFAHLMEEPLGSDPFSWKLPSLDYERKTKVDFDDFLPAIRKPQTPTSLAGSAKGGQDGSQRSSIHFETEEANRSFLSGIKTILKKSPEPKEDPAHLSDSSSSSGSIVSFKSADSIKSRPGIPRLAGDGGERTSPERREPGTGRKDDDVASIMKKYLQK C36BFD5C6FB4258B cac1s_human Voltage-dependent L-type calcium channel subunit alpha-1S CACNA1S CACH1 CACN1 CACNL1A3 Calcium channel, L type, alpha-1 polypeptide, isoform 3, skeletal muscle Voltage-gated calcium channel subunit alpha Cav1.1 protein protein human Homo sapiens Human MEPSSPQDEGLRKKQPKKPVPEILPRPPRALFCLTLENPLRKACISIVEWKPFETIILLTIFANCVALAVYLPMPEDDNNSLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRSGWNVLDFTIVFLGVFTVILEQVNVIQSHTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVPSLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENEEPSPCARTGSGRRCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYWVNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLDEDLRGYMSWITQGEVMDVEDFREGKLSLDEGGSDTESLYEIAGLNKIIQFIRHWRQWNRIFRWKCHDIVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTRLQDIANRVLLSLFTTEMLMKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMTPLGISVLRCIRLLRIFKITKYWTSLSNLVASLLNSIRSIASLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQVLTGEDWTSMMYNGIMAYGGPSYPGMLVCIYFIILFVCGNYILLNVFLAIAVDNLAEAESLTSAQKAKAEEKKRRKMSKGLPDKSEEEKSTMAKKLEQKPKGEGIPTTAKLKIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPLSPRPRPLAELQLKEKAVPIPEASSFFIFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILKHFDIGFTSVFTVEIVLKMTTYGAFLHKGSFCRNYFNMLDLLVVAVSLISMGLESSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCMFVAISTIGNIVLVTTLLQFMFACIGVQLFKGKFFRCTDLSKMTEEECRGYYYVYKDGDPMQIELRHREWVHSDFHFDNVLSAMMSLFTVSTFEGWPQLLYKAIDSNAEDVGPIYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCELDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYIVTSSYFEYLMFALIMLNTICLGMQHYNQSEQMNHISDILNVAFTIIFTLEMILKLMAFKARGYFGDPWNVFDFLIVIGSIIDVILSEIDTFLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLIKLLSRAEGVRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQMFGKIALVDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEILLACSYGKLCDPESDYAPGEEYTCGTNFAYYYFISFYMLCAFLVINLFVAVIMDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCPHRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGNFEQANEELRAIIKKIWKRTSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPKKDIVQIQAGLRTIEEEAAPEICRTVSGDLAAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNSLPPVMANQRPLQFAEIEMEEMESPVFLEDFPQDPRTNPLARANTNNANANVAYGNSNHSNSHVFSSVHYEREFPEETETPATRGRALGQPCRVLGPHSKPCVEMLKGLLTQRAMPRGQAPPAPCQCPRVESSMPEDRKSSTPGSLHEETPHSRSTRENTSRCSAPATALLIQKALVRGGLGTLAADANFIMATGQALADACQMEPEEVEIMATELLKGREAPEGMASSLGCLNLGSSLGSLDQHQGSQETLIPPRL 7B7446727E578913 disc1_human Disrupted in schizophrenia 1 protein DISC1 KIAA0457 protein protein human Homo sapiens Human MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFRRRRLARRPGYMRSSTGPGIGFLSPAVGTLFRFPGGVSGEESHHSESRARQCGLDSRGLLVRSPVSKSAAAPTVTSVRGTSAHFGIQLRGGTRLPDRLSWPCGPGSAGWQQEFAAMDSSETLDASWEAACSDGARRVRAAGSLPSAELSSNSCSPGCGPEVPPTPPGSHSAFTSSFSFIRLSLGSAGERGEAEGCPPSREAESHCQSPQEMGAKAASLDGPHEDPRCLSRPFSLLATRVSADLAQAARNSSRPERDMHSLPDMDPGSSSSLDPSLAGCGGDGSSGSGDAHSWDTLLRKWEPVLRDCLLRNRRQMEVISLRLKLQKLQEDAVENDDYDKAETLQQRLEDLEQEKISLHFQLPSRQPALSSFLGHLAAQVQAALRRGATQQASGDDTHTPLRMEPRLLEPTAQDSLHVSITRRDWLLQEKQQLQKEIEALQARMFVLEAKDQQLRREIEEQEQQLQWQGCDLTPLVGQLSLGQLQEVSKALQDTLASAGQIPFHAEPPETIRSLQERIKSLNLSLKEITTKVCMSEKFCSTLRKKVNDIETQLPALLEAKMHAISGNHFWTAKDLTEEIRSLTSEREGLEGLLSKLLVLSSRNVKKLGSVKEDYNRLRREVEHQETAYETSVKENTMKYMETLKNKLCSCKCPLLGKVWEADLEACRLLIQSLQLQEARGSLSVEDERQMDDLEGAAPPIPPRLHSEDKRKTPLKVLEEWKTHLIPSLHCAGGEQKEESYILSAELGEKCEDIGKKLLYLEDQLHTAIHSHDEDLIQSLRRELQMVKETLQAMILQLQPAKEAGEREAAASCMTAGVHEAQA 63C3FDF2F59830C6 ubp25_human Ubiquitin carboxyl-terminal hydrolase 25 USP25 USP21 Ubiquitin-specific-processing protease 25 Deubiquitinating enzyme 25 USP on chromosome 21 Ubiquitin thioesterase 25 protein protein human Homo sapiens Human MTVEQNVLQQSAAQKHQQTFLNQLREITGINDTQILQQALKDSNGNLELAVAFLTAKNAKTPQQEETTYYQTALPGNDRYISVGSQADTNVIDLTGDDKDDLQRAIALSLAESNRAFRETGITDEEQAISRVLEASIAENKACLKRTPTEVWRDSRNPYDRKRQDKAPVGLKNVGNTCWFSAVIQSLFNLLEFRRLVLNYKPPSNAQDLPRNQKEHRNLPFMRELRYLFALLVGTKRKYVDPSRAVEILKDAFKSNDSQQQDVSEFTHKLLDWLEDAFQMKAEEETDEEKPKNPMVELFYGRFLAVGVLEGKKFENTEMFGQYPLQVNGFKDLHECLEAAMIEGEIESLHSENSGKSGQEHWFTELPPVLTFELSRFEFNQALGRPEKIHNKLEFPQVLYLDRYMHRNREITRIKREEIKRLKDYLTVLQQRLERYLSYGSGPKRFPLVDVLQYALEFASSKPVCTSPVDDIDASSPPSGSIPSQTLPSTTEQQGALSSELPSTSPSSVAAISSRSVIHKPFTQSRIPPDLPMHPAPRHITEEELSVLESCLHRWRTEIENDTRDLQESISRIHRTIELMYSDKSMIQVPYRLHAVLVHEGQANAGHYWAYIFDHRESRWMKYNDIAVTKSSWEELVRDSFGGYRNASAYCLMYINDKAQFLIQEEFNKETGQPLVGIETLPPDLRDFVEEDNQRFEKELEEWDAQLAQKALQEKLLASQKLRESETSVTTAQAAGDPEYLEQPSRSDFSKHLKEETIQIITKASHEHEDKSPETVLQSAIKLEYARLVKLAQEDTPPETDYRLHHVVVYFIQNQAPKKIIEKTLLEQFGDRNLSFDERCHNIMKVAQAKLEMIKPEEVNLEEYEEWHQDYRKFRETTMYLIIGLENFQRESYIDSLLFLICAYQNNKELLSKGLYRGHDEELISHYRRECLLKLNEQAAELFESGEDREVNNGLIIMNEFIVPFLPLLLVDEMEEKDILAVEDMRNRWCSYLGQEMEPHLQEKLTDFLPKLLDCSMEIKSFHEPPKLPSYSTHELCERFARIMLSLSRTPADGR 0B9CECDCAD619CF2 sh3bp2-tnks2-5 2 6 unspecified role unspecified role neutral component neutral component region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arc region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 35 39 direct interaction direct interaction TNKS2 ARC domains 1, 4, and 5 each bound the 3BP2 peptide (dissociation constant (KD) = 6.9 +/- 2.8 uM, 6.3 +/- 1.2 uM, and 1.3 +/- 0.2 uM, respectively). The ARC2-3 unit also bound the 3BP2 peptide (KD = 2.3 +/- 0.3 μM), Fig. 1B, 1C sh3bp2-tnks2-6 2 6 unspecified role unspecified role neutral component neutral component region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P78314:p.Arg415Ala mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:21:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg415ala' Tue Jun 30 16:20:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg415Ala' P78314:p.Gly420Ala mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain G A Wed May 02 19:20:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly420ala' Tue Jun 30 16:56:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly420Ala' P78314:p.Asp419Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain D A Wed May 02 19:46:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp419ala' Tue Jun 30 20:26:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp419Ala' chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arc region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9H2K2:p.Trp591Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A Wed May 02 16:47:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp591ala' Tue Jun 30 18:33:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Trp591Ala' Q9H2K2:p.Phe593Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain F A Wed May 02 15:14:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe593ala' Tue Jun 30 17:16:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe593Ala' Q9H2K2:p.Glu598Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E A Wed May 02 15:17:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu598ala' Tue Jun 30 18:15:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu598Ala' Q9H2K2:p.[Tyr536Ala;Tyr569Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain Y A certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 17:17:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr536ala,tyr569ala' Tue Jun 30 19:49:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr536Ala;Tyr569Ala]' Q9H2K2:p.Arg525Asp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R D Wed May 02 14:36:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg525asp' Tue Jun 30 19:20:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg525Asp' Q9H2K2:p.Ser527Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:41:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser527ala' Tue Jun 30 17:40:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser527Ala' Q9H2K2:p.[Trp591Ala;Phe593Ala;Glu598Ala] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain W A certain certain sequence position certain certain certain sequence position certain F A certain certain sequence position certain certain certain sequence position certain E A Wed May 02 14:46:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'trp591ala,phe593ala,glu598ala' Tue Jun 30 15:59:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Trp591Ala;Phe593Ala;Glu598Ala]' Q9H2K2:p.Tyr569Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 16:17:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr569ala' Tue Jun 30 16:41:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr569Ala' Q9H2K2:p.Asn565Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N A Wed May 02 15:21:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn565ala' Tue Jun 30 18:27:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn565Ala' Q9H2K2:p.Tyr536Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 18:51:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr536ala' Tue Jun 30 17:32:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr536Ala' Q9H2K2:p.Arg525Ala mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:09:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg525ala' Tue Jun 30 18:24:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg525Ala' Q9H2K2:p.Leu560Trp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L W Wed May 02 15:36:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu560trp' Tue Jun 30 18:14:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu560Trp' ecoli Escherichia coli (strain K12) 50 43 direct interaction direct interaction TNKS2 ARC domains 1, 4, and 5 each bound the 3BP2 peptide (dissociation constant (KD) = 6.9 +/- 2.8 uM, 6.3 +/- 1.2 uM, and 1.3 +/- 0.2 uM, respectively). The ARC2-3 unit also bound the 3BP2 peptide (KD = 2.3 +/- 0.3 μM), Fig. 3B, 4B, 4C, Supp Fig. 7A, Supp. Table 2 sh3bp2-tnks2-7 3 14 unspecified role unspecified role unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 4 unspecified role unspecified role unspecified role unspecified role region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9H2K2:p.[Leu92Trp;Leu245Trp;Leu560Trp;Leu713Trp] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L W certain certain sequence position certain certain certain sequence position certain L W certain certain sequence position certain certain certain sequence position certain L W certain certain sequence position certain certain certain sequence position certain L W Fri Jul 22 10:53:30 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu713trp,leu92trp,leu245trp,leu560trp' Wed May 02 18:08:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu92trp,leu245trp,leu560trp,leu713trp' Tue Jun 30 20:19:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu92Trp;Leu245Trp;Leu560Trp;Leu713Trp]' drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction Fig. 3D sh3bp2-tnks2-8 1 4 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9H2K2:p.[Leu92Trp;Leu245Trp;Leu560Trp;Leu713Trp] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L W certain certain sequence position certain certain certain sequence position certain L W certain certain sequence position certain certain certain sequence position certain L W certain certain sequence position certain certain certain sequence position certain L W Fri Jul 22 10:53:29 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu713trp,leu92trp,leu245trp,leu560trp' Wed May 02 15:32:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu92trp,leu245trp,leu560trp,leu713trp' Tue Jun 30 19:51:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu92Trp;Leu245Trp;Leu560Trp;Leu713Trp]' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9H2K2:p.Asn413Gln mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain N Q Wed May 02 19:53:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn413gln' Tue Jun 30 16:55:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn413Gln' Q9H2K2:p.Val416His mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain V H Wed May 02 14:38:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val416his' Tue Jun 30 15:44:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val416His' 14 unspecified role unspecified role unspecified role unspecified role region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3E mcl1-tnks2 2 4 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 5 unspecified role unspecified role neutral component neutral component n-terminal fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 86 82 direct interaction direct interaction MCL1 also bound to the 1st, 2nd and 5th ARC region of TNKS2 Fig. 4B, Supp Fig. 5, Supp. Table 2 tnks1bp1-tnks2 2 16 unspecified role unspecified role neutral component neutral component n-terminal fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 90 93 direct interaction direct interaction TNKS1BP1 also bound to the 1st, 2nd and 5th ARC region of TNKS2 Fig. 4B, Supp Fig. 5, Supp. Table 2 axin1-tnks2 2 10 unspecified role unspecified role neutral component neutral component O15169:p.Arg22Ala mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain R A Wed May 02 18:55:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg22ala' Tue Jun 30 17:13:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg22Ala' O15169:p.Pro24Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Wed May 02 16:52:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro24ala' Tue Jun 30 19:51:31 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro24Ala' O15169:p.Val25Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain V A Wed May 02 19:32:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val25ala' Tue Jun 30 18:20:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val25Ala' O15169:p.Glu29Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain E A Wed May 02 16:08:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu29ala' Tue Jun 30 16:48:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu29Ala' O15169:p.Pro23Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Wed May 02 16:32:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro23ala' Tue Jun 30 18:43:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro23Ala' O15169:p.Gly27Ala mutation disrupting mutation disrupting interaction mutation disrupting alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain G A Wed May 02 20:32:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly27ala' Tue Jun 30 19:13:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly27Ala' n-terminal fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O15169:p.Pro26Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing alanine scanning alanine scanning certain certain sequence position certain certain certain sequence position certain P A Wed May 02 19:21:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro26ala' Tue Jun 30 20:22:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro26Ala' chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 104 107 direct interaction direct interaction AXIN1 also bound to the 1st, 2nd and 5th ARC region of TNKS2 Fig. 4B, 4C, Supp Fig. 5, Supp. Table 2 tnks2-usp25 2 31 unspecified role unspecified role neutral component neutral component n-terminal fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 116 113 direct interaction direct interaction UBP25 also bound to the 1st, 2nd and 5th ARC region of TNKS2 Fig. 4B, Supp Fig. 5, Supp. Table 2 lnpep-tnks2 2 7 unspecified role unspecified role neutral component neutral component n-terminal fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 121 123 direct interaction direct interaction LNPEP also bound to the 1st, 2nd 3rd and 5th ARC region of TNKS2 Fig. 4B, Supp Fig. 5, Supp. Table 2 numa1-tnks2 2 4 unspecified role unspecified role neutral component neutral component arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role neutral component neutral component n-terminal fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction NUMA1 also bound to the 1st, 2nd and 5th ARC region of TNKS2 Fig. 4B, Supp Fig. 5, Supp. Table 2 cacna1s-tnks2 2 4 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 29 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 137 140 direct interaction direct interaction CACNA1S also bound to the 1st, 2nd and 5th ARC region of TNKS2 Fig. 4B, Supp Fig. 5, Supp. Table 2 hoxb2-tnks2 2 15 unspecified role unspecified role neutral component neutral component n-terminal fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 149 145 direct interaction direct interaction CACNA1S also bound to the 1st, 2nd and 5th ARC region of TNKS2 Fig. 4B, Supp Fig. 5, Supp. Table 2 ppp1r12c-tnks2 2 17 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 152 157 direct interaction direct interaction PPP1R12C also bound to the 1st, 2nd and 5th ARC region of TNKS2 Fig. 4B, Supp Fig. 5, Supp. Table 2 fnbp1-tnks2 2 19 unspecified role unspecified role neutral component neutral component n-terminal fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction FNBP1 also bound to the 1st, 2nd 3rd and 5th ARC region of TNKS2 Fig. 4B, Supp Fig. 5, Supp. Table 2 terf1-tnks2 2 27 unspecified role unspecified role neutral component neutral component n-terminal fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component Q9H2K2:p.Leu560Trp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L W Wed May 02 18:28:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu560trp' Tue Jun 30 17:44:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu560Trp' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 173 169 direct interaction direct interaction TERF1 also bound to the 1st, 2nd and 5th ARC region of TNKS2 Fig. 4B, Supp Fig. 5, Supp. Table 2 sh3bp2-tnks2-9 2 4 unspecified role unspecified role neutral component neutral component arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P78314:p.[Gln414Ala;Ser416Glu;Pro417Ala;Pro418Gly;Gln421Glu;Ser422Glu;Phe423Ala] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain Q A certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain P A certain certain sequence position certain certain certain sequence position certain P G certain certain sequence position certain certain certain sequence position certain Q E certain certain sequence position certain certain certain sequence position certain S E certain certain sequence position certain certain certain sequence position certain F A Wed May 02 14:55:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln414ala,ser416glu,pro417ala,pro418gly,gln421glu,ser422glu,phe423ala' Tue Jun 30 15:36:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln414Ala;Ser416Glu;Pro417Ala;Pro418Gly;Gln421Glu;Ser422Glu;Phe423Ala]' P78314:p.[Gln414Ala;Phe423Ala] mutation mutation certain certain sequence position certain certain certain sequence position certain Q A certain certain sequence position certain certain certain sequence position certain F A Wed May 02 18:44:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln414ala,phe423ala' Tue Jun 30 17:27:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gln414Ala;Phe423Ala]' chemical synthesis Chemical synthesis (Chemical synthesis) 182 177 direct interaction direct interaction TNKS2 ARC domains 1, 4, and 5 each bound the 3BP2 peptide (dissociation constant (KD) = 6.9 +/- 2.8 uM, 6.3 +/- 1.2 uM, and 1.3 +/- 0.2 uM, respectively). The ARC2-3 unit also bound the 3BP2 peptide (KD = 2.3 +/- 0.3 μM), Fig. 5B axin1-tnks2-1 2 4 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component n-terminal fluorescein fluorescein label fluorescein n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 192 188 direct interaction direct interaction AXIN1 also bound to the 1st, 2nd and 5th ARC region of TNKS2 Supp. Fig. 6C sh3bp2-tnks2-10 2 4 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component P78314:p.[Pro418_Asp419delinsValPro;Ser422Gln] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S Q certain certain sequence position certain certain certain sequence position certain PD VP Thu Jul 07 12:15:54 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was pro418val_asp419pro_ser422gln Fri Jul 22 11:00:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'pro418val,asp419pro,ser422gln' Wed May 02 16:55:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro_asp418-419val_pro,ser422gln' Tue Jun 30 18:18:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro418_Asp419delinsValPro;Ser422Gln]' P78314:p.[Pro418_Asp419delinsValPro;Ser422Glu] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain PD VP certain certain sequence position certain certain certain sequence position certain S E Thu Jul 07 12:15:51 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was pro418val_asp419pro_ser422glu Fri Jul 22 10:57:48 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'pro418val,asp419pro,ser422glu' Wed May 02 18:07:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro_asp418-419val_pro,ser422glu' Tue Jun 30 20:26:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro418_Asp419delinsValPro;Ser422Glu]' P78314:p.[Pro418_Asp419delinsValPro;Ser422Asn] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain PD VP certain certain sequence position certain certain certain sequence position certain S N Thu Jul 07 12:15:52 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was pro418val_asp419pro_ser422asn Fri Jul 22 10:57:05 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'pro418val,asp419pro,ser422asn' Wed May 02 15:54:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro_asp418-419val_pro,ser422asn' Tue Jun 30 15:46:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro418_Asp419delinsValPro;Ser422Asn]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P78314:p.Pro418_Asp419delinsValPro mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain PD VP Thu Jul 07 12:17:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was pro418val_asp419pro Fri Jul 22 11:00:56 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'pro418val,asp419pro' Wed May 02 15:07:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro_asp418-419val_pro' Tue Jun 30 18:06:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro418_Asp419delinsValPro' region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P78314:p.[Pro418_Asp419delinsValPro;Ser422Asp] mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain S D certain certain sequence position certain certain certain sequence position certain PD VP Thu Jul 07 12:17:16 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was pro418val_asp419pro_ser422asp Fri Jul 22 10:56:38 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'pro418val,asp419pro,ser422asp' Wed May 02 20:05:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro_asp418-419val_pro,ser422asp' Tue Jun 30 16:40:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Pro418_Asp419delinsValPro;Ser422Asp]' chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction TNKS2 ARC domains 1, 4, and 5 each bound the 3BP2 peptide (dissociation constant (KD) = 6.9 +/- 2.8 uM, 6.3 +/- 1.2 uM, and 1.3 +/- 0.2 uM, respectively). The ARC2-3 unit also bound the 3BP2 peptide (KD = 2.3 +/- 0.3 μM), Supp. Fig. 6C disc1-tnks2 2 30 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp Fig. 7A strn-tnks2 2 4 unspecified role unspecified role neutral component neutral component arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 23 unspecified role unspecified role neutral component neutral component region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp Fig. 7A fat4-tnks2 2 25 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp Fig. 7A fat4-tnks2-1 2 25 unspecified role unspecified role neutral component neutral component region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp Fig. 7A rad54l-tnks2 2 4 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q9H2K2:p.Leu560Trp mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain L W Wed May 02 15:38:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu560trp' Tue Jun 30 16:56:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu560Trp' ecoli Escherichia coli (strain K12) 21 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 242 245 direct interaction direct interaction Supp Figs. 7A, 7c babam1-tnks2 2 4 unspecified role unspecified role neutral component neutral component arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 24 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 249 253 direct interaction direct interaction Supp Fig. 7A, 7C babam1-tnks2-1 2 4 unspecified role unspecified role neutral component neutral component Q9H2K2:p.Leu560Trp mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L W Wed May 02 18:14:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu560trp' Tue Jun 30 19:48:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu560Trp' region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 24 unspecified role unspecified role neutral component neutral component region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp Fig. 7A, 7C cep170-tnks2 2 4 unspecified role unspecified role neutral component neutral component arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 20 unspecified role unspecified role neutral component neutral component region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp Fig. 7A fastk-tnks2 2 4 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 26 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp Fig. 7A tnks2-taok2 2 4 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 22 unspecified role unspecified role neutral component neutral component region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 287 284 direct interaction direct interaction Supp Fig. 7A myo18b-tnks2 2 28 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp Fig. 7A dido1-tnks2 2 12 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role neutral component neutral component region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp Fig. 7A tnks2-bcr 3 27 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 4 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 24 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 21 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. 23 unspecified role unspecified role prey prey human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. association association Sup. Fig. 7B Binding of RAD54 and TERF1 was abolished by ARC xx3xx and xxxxx mutations whereas binding of MERIT40, BCR, and STRIATIN was not greatly affected. bcr-tnks2 2 4 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined arc4 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 317 315 direct interaction direct interaction Supp Fig. 7A, 7C disc1-tnks2 1 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q811T9:p.Gly226Arg mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G R Wed May 02 15:12:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly226arg' Tue Jun 30 16:56:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly226Arg' physical association physical association Fig. 6 strn-tnks2-1 1 4 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 18 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O55106:p.Gly305Arg mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G R Wed May 02 18:10:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly305arg' Tue Jun 30 19:38:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly305Arg' physical association physical association Fig. 6 fat4-tnks2-2 1 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait Q2PZL6:p.[Gly4578Arg;Gly4834Arg] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G R certain certain sequence position certain certain certain sequence position certain G R Wed May 02 16:53:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly4578arg,gly4834arg' Tue Jun 30 19:54:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly4578Arg;Gly4834Arg]' region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q2PZL6:p.Gly4578Arg mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G R Wed May 02 16:31:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly4578arg' Tue Jun 30 18:27:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly4578Arg' Q2PZL6:p.Gly4834Arg mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G R Wed May 02 18:53:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly4834arg' Tue Jun 30 18:33:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly4834Arg' physical association physical association Fig. 6 rad54l-tnks2-1 1 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 21 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q92698:p.Gly696Arg mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G R Wed May 02 15:23:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly696arg' Tue Jun 30 18:37:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly696Arg' physical association physical association Fig. 6 bcr-tnks2-1 1 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P11274:p.Gly119Arg mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G R Wed May 02 15:03:03 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly119arg' Tue Jun 30 19:51:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly119Arg' 4 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 6 babam1-tnks2-2 1 4 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 24 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9NWV8:p.Gly33Arg mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G R Wed May 02 20:21:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly33arg' Tue Jun 30 18:02:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly33Arg' Q9NWV8:p.Gly51Arg mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G R Wed May 02 15:19:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly51arg' Tue Jun 30 17:25:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly51Arg' Q9NWV8:p.[Gly33Arg;Gly51Arg] mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain G R certain certain sequence position certain certain certain sequence position certain G R Wed May 02 14:58:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly33arg,gly51arg' Tue Jun 30 16:26:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Gly33Arg;Gly51Arg]' physical association physical association Fig. 6