mpidb The Microbial Protein Interaction Database CitA/CitB two-component system regulating citrate fermentation in Escherichia coli and its relation to the DcuS/DcuR system in vivo. CitA/CitB two-component system regulating citrate fermentation in Escherichia coli and its relation to the DcuS/DcuR system in vivo. J. Bacteriol. (0021-9193) 2012 imex curation Scheu P.D., Witan J., Rauschmeier M., Graf S., Liao Y.F., Ebert-Jung A., Basche T., Erker W., Unden G. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Scheu P.D., Witan J., Rauschmeier M., Graf S., Liao Y.F., Ebert-Jung A., Basche T., Erker W., Unden G. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation CitA/CitB two-component system regulating citrate fermentation in Escherichia coli and its relation to the DcuS/DcuR system in vivo. CitA/CitB two-component system regulating citrate fermentation in Escherichia coli and its relation to the DcuS/DcuR system in vivo. J. Bacteriol. (0021-9193) 2012 imex curation Scheu P.D., Witan J., Rauschmeier M., Graf S., Liao Y.F., Ebert-Jung A., Basche T., Erker W., Unden G. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Scheu P.D., Witan J., Rauschmeier M., Graf S., Liao Y.F., Ebert-Jung A., Basche T., Erker W., Unden G. Accepted 2012-DEC-05 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation dcur_ecoli Transcriptional regulatory protein DcuR yjdG dcuR b4124 JW4085 protein protein ecoli Escherichia coli (strain K12) MINVLIIDDDAMVAELNRRYVAQIPGFQCCGTASTLEKAKEIIFNSDTPIDLILLDIYMQKENGLDLLPVLHNARCKSDVIVISSAADAATIKDSLHYGVVDYLIKPFQASRFEEALTGWRQKKMALEKHQYYDQAELDQLIHGSSSNEQDPRRLPKGLTPQTLRTLCQWIDAHQDYEFSTDELANEVNISRVSCRKYLIWLVNCHILFTSIHYGVTGRPVYRYRIQAEHYSLLKQYCQ 4C111A0351F84FDA dcus_ecoli Sensor histidine kinase DcuS yjdH dcuS b4125 JW4086 Fumarate sensor protein protein ecoli Escherichia coli (strain K12) MRHSLPYRMLRKRPMKLSTTVILMVSAVLFSVLLVVHLIYFSQISDMTRDGLANKALAVARTLADSPEIRQGLQKKPQESGIQAIAEAVRKRNDLLFIVVTDMQSLRYSHPEAQRIGQPFKGDDILKALNGEENVAINRGFLAQALRVFTPIYDENHKQIGVVAIGLELSRVTQQINDSRWSIIWSVLFGMLVGLIGTCILVKVLKKILFGLEPYEISTLFEQRQAMLQSIKEGVVAVDDRGEVTLINDAAQELLNYRKSQDDEKLSTLSHSWSQVVDVSEVLRDGTPRRDEEITIKDRLLLINTVPVRSNGVIIGAISTFRDKTEVRKLMQRLDGLVNYADALRERSHEFMNKLHVILGLLHLKSYKQLEDYILKTANNYQEEIGSLLGKIKSPVIAGFLISKINRATDLGHTLILNSESQLPDSGSEDQVATLITTLGNLIENALEALGPEPGGEISVTLHYRHGWLHCEVNDDGPGIAPDKIDHIFDKGVSTKGSERGVGLALVKQQVENLGGSIAVESEPGIFTQFFVQIPWDGERSNR 653C369344CBA238 dpib_ecoli Sensor histidine kinase DpiB ybeP Sensor histidine kinase CitA dpiB citA mpdB b0619 JW0611 protein protein ecoli Escherichia coli (strain K12) MLQLNENKQFAFFQRLAFPLRIFLLILVFSIFVIAALAQYFTASFEDYLTLHVRDMAMNQAKIIASNDSVISAVKTRDYKRLATIANKLQRDTDFDYVVIGDRHSIRLYHPNPEKIGYPMQFTKQGALEKGESYFITGKGSMGMAMRAKTPIFDDDGKVIGVVSIGYLVSKIDSWRAEFLLPMAGVFVVLLGILMLLSWFLAAHIRRQMMGMEPKQIARVVRQQEALFSSVYEGLIAVDPHGYITAINRNARKMLGLSSPGRQWLGKPIVEVVRPADFFTEQIDEKRQDVVANFNGLSVIANREAIRSGDDLLGAIISFRSKDEISTLNAQLTQIKQYVESLRTLRHEHLNWMSTLNGLLQMKEYDRVLAMVQGESQAQQQLIDSLREAFADRQVAGLLFGKVQRARELGLKMIIVPGSQLSQLPPGLDSTEFAAIVGNLLDNAFEASLRSDEGNKIVELFLSDEGDDVVIEVADQGCGVPESLRDKIFEQGVSTRADEPGEHGIGLYLIASYVTRCGGVITLEDNDPCGTLFSIYIPKVKPNDSSINPIDR 3E3F0E081ABD6E77 dcus-dcus-4 1 4 unspecified role unspecified role fluorescence donor fluorescence donor p0aec8-- P0AEC8-- cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept p0aec8-- P0AEC8-- yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction figure 2 dcus-dpib-2 1 4 unspecified role unspecified role fluorescence donor fluorescence donor p0aec8-- P0AEC8-- cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept p77510-- P77510-- yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined proximity proximity close-contact colocalization neighbourhood interaction figure 2 dcus-dcur 2 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association figure 3 dcus-dcus-3 2 4 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association figure 3