IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Large-scale protein-protein interaction analysis in Arabidopsis mesophyll protoplasts by split firefly luciferase complementation. Large-scale protein-protein interaction analysis in Arabidopsis mesophyll protoplasts by split firefly luciferase complementation. PLoS ONE 2011 imex curation Li J.F., Bush J., Xiong Y., Li L., McCormack M. The Z-factor was determined as described in the publication is reflective of both the signal dynamic range and the data variation associated with the signal measurements in a given HTS assay, and therefore is a quantifiable parameter for assay quality evaluation. The firefly luciferase N (FLuc aa1-398) and C terminal (FLuc aa394-550) ends were tagged onto the interacting proteins. jli@molbio.mgh.harvard.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions arath-protoplast Arabidopsis thaliana protoplast Protoplast defined as a membrane-bound cell from which the outer wall has been partially or completely removed. split firefly luciferase complementation split firefly luciferase complementation tag luciferase tag visualisation by luciferase assay tag luciferase Li J.F., Bush J., Xiong Y., Li L., McCormack M. The Z-factor was determined as described in the publication is reflective of both the signal dynamic range and the data variation associated with the signal measurements in a given HTS assay, and therefore is a quantifiable parameter for assay quality evaluation. The firefly luciferase N (FLuc aa1-398) and C terminal (FLuc aa394-550) ends were tagged onto the interacting proteins. jli@molbio.mgh.harvard.edu Accepted 2012-AUG-14 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. PLoS ONE 2011 Only protein-protein interactions imex curation Large-scale protein-protein interaction analysis in Arabidopsis mesophyll protoplasts by split firefly luciferase complementation. Large-scale protein-protein interaction analysis in Arabidopsis mesophyll protoplasts by split firefly luciferase complementation. PLoS ONE 2011 imex curation Li J.F., Bush J., Xiong Y., Li L., McCormack M. The Z-factor was determined as described in the publication is reflective of both the signal dynamic range and the data variation associated with the signal measurements in a given HTS assay, and therefore is a quantifiable parameter for assay quality evaluation. The firefly luciferase N (FLuc aa1-398) and C terminal (FLuc aa394-550) ends were tagged onto the interacting proteins. jli@molbio.mgh.harvard.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions arath-protoplast Arabidopsis thaliana protoplast Protoplast defined as a membrane-bound cell from which the outer wall has been partially or completely removed. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Li J.F., Bush J., Xiong Y., Li L., McCormack M. The Z-factor was determined as described in the publication is reflective of both the signal dynamic range and the data variation associated with the signal measurements in a given HTS assay, and therefore is a quantifiable parameter for assay quality evaluation. The firefly luciferase N (FLuc aa1-398) and C terminal (FLuc aa394-550) ends were tagged onto the interacting proteins. jli@molbio.mgh.harvard.edu Accepted 2012-AUG-14 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. PLoS ONE 2011 Only protein-protein interactions imex curation iaa13_arath Auxin-responsive protein IAA13 Indoleacetic acid-induced protein 13 IAA13 F4P9.8 At2g33310 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MITELEMGKGESELELGLGLSLGGGTAAKIGKSGGGGAWGERGRLLTAKDFPSVGSKRAADSASHAGSSPPRSSSQVVGWPPIGSHRMNSLVNNQATKSAREEEEAGKKKVKDDEPKDVTKKVNGKVQVGFIKVNMDGVAIGRKVDLNAHSSYENLAQTLEDMFFRTNPGTVGLTSQFTKPLRLLDGSSEFVLTYEDKEGDWMLVGDVPWRMFINSVKRLRVMKTSEANGLAARNQEPNERQRKQPV 5B57E065DA786CD4 iaa1_arath Auxin-responsive protein IAA1 Indoleacetic acid-induced protein 1 IAA1 At4g14560 dl3320w FCAALL.409 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEVTNGLNLKDTELRLGLPGAQEEQQLELSCVRSNNKRKNNDSTEESAPPPAKTQIVGWPPVRSNRKNNNNKNVSYVKVSMDGAPYLRKIDLKMYKNYPELLKALENMFKFTVGEYSEREGYKGSGFVPTYEDKDGDWMLVGDVPWDMFSSSCQKLRIMKGSEAPTAL DIP protein P49677 original sequence version: 105 17CA9B3BEB7962EE arfe_arath Auxin response factor 5 Transcription factor MONOPTEROS Auxin-responsive protein IAA24 ARF5 IAA24 MP At1g19850 F6F9.10 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMASLSCVEDKMKTSCLVNGGGTITTTTSQSTLLEEMKLLKDQSGTRKPVINSELWHACAGPLVCLPQVGSLVYYFSQGHSEQVAVSTRRSATTQVPNYPNLPSQLMCQVHNVTLHADKDSDEIYAQMSLQPVHSERDVFPVPDFGMLRGSKHPTEFFCKTLTASDTSTHGGFSVPRRAAEKLFPPLDYSAQPPTQELVVRDLHENTWTFRHIYRGQPKRHLLTTGWSLFVGSKRLRAGDSVLFIRDEKSQLMVGVRRANRQQTALPSSVLSADSMHIGVLAAAAHATANRTPFLIFYNPRACPAEFVIPLAKYRKAICGSQLSVGMRFGMMFETEDSGKRRYMGTIVGISDLDPLRWPGSKWRNLQVEWDEPGCNDKPTRVSPWDIETPESLFIFPSLTSGLKRQLHPSYFAGETEWGSLIKRPLIRVPDSANGIMPYASFPSMASEQLMKMMMRPHNNQNVPSFMSEMQQNIVMGNGGLLGDMKMQQPLMMNQKSEMVQPQNKLTVNPSASNTSGQEQNLSQSMSAPAKPENSTLSGCSSGRVQHGLEQSMEQASQVTTSTVCNEEKVNQLLQKPGASSPVQADQCLDITHQIYQPQSDPINGFSFLETDELTSQVSSFQSLAGSYKQPFILSSQDSSAVVLPDSTNSPLFHDVWDTQLNGLKFDQFSPLMQQDLYASQNICMSNSTTSNILDPPLSNTVLDDFCAIKDTDFQNHPSGCLVGNNNTSFAQDVQSQITSASFADSQAFSRQDFPDNSGGTGTSSSNVDFDDCSLRQNSKGSSWQKIATPRVRTYTKVQKTGSVGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSGWKLVYVDYESDVLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLNSAGINDLKTSVS D20D348369757F09 arff_arath Auxin response factor 6 ARF6 T4K22.6 At1g30330 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRLSSAGFNPQPHEVTGEKRVLNSELWHACAGPLVSLPPVGSRVVYFPQGHSEQVAASTNKEVDAHIPNYPSLHPQLICQLHNVTMHADVETDEVYAQMTLQPLNAQEQKDPYLPAELGVPSRQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELMARDLHDNEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDKNQLLLGIRRANRPQTVMPSSVLSSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRMLFETEESSVRRYMGTITGICDLDPTRWANSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFPLRLKRPWPPGLPSFHGLKEDDMGMSMSSPLMWDRGLQSLNFQGMGVNPWMQPRLDTSGLLGMQNDVYQAMAAAALQDMRGIDPAKAAASLLQFQNSPGFSMQSPSLVQPQMLQQQLSQQQQQLSQQQQQQQQLSQQQQQQLSQQQQQQLSQQQQQQLSQQQQQQAYLGVPETHQPQSQAQSQSNNHLSQQQQQVVDNHNPSASSAAVVSAMSQFGSASQPNTSPLQSMTSLCHQQSFSDTNGGNNPISPLHTLLSNFSQDESSQLLHLTRTNSAMTSSGWPSKRPAVDSSFQHSGAGNNNTQSVLEQLGQSHTSNVPPNAVSLPPFPGGRECSIEQEGSASDPHSHLLFGVNIDSSSLLMPNGMSNLRSIGIEGGDSTTLPFTSSNFNNDFSGNLAMTTPSSCIDESGFLQSSENLGSENPQSNTFVKVYKSGSFGRSLDISKFSSYHELRSELARMFGLEGQLEDPVRSGWQLVFVDRENDVLLLGDDPWPEFVSSVWCIKILSPQEVQQMGKRGLELLNSAPSSNNVDKLPSNGNCDDFGNRSDPRNLGNGIASVGGSFNY 8A7A1621A0E934E3 iaa28_arath Auxin-responsive protein IAA28 IAA28 Indoleacetic acid-induced protein 28 T1N24.24 F18A17.6 At5g25890 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEEEKRLELRLAPPCHQFTSNNNINGSKQKSSTKETSFLSNNRVEVAPVVGWPPVRSSRRNLTAQLKEEMKKKESDEEKELYVKINMEGVPIGRKVNLSAYNNYQQLSHAVDQLFSKKDSWDLNRQYTLVYEDTEGDKVLVGDVPWEMFVSTVKRLHVLKTSHAFSLSPRKHGKE 7A58B615DBC8FB47 iaa6_arath Auxin-responsive protein IAA6 Indoleacetic acid-induced protein 6 IAA6 SHY1 F14G24.10 At1g52830 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAKEGLALEITELRLGLPGDNYSEISVCGSSKKKKRVLSDMMTSSALDTENENSVVSSVEDESLPVVKSQAVGWPPVCSYRRKKNNEEASKAIGYVKVSMDGVPYMRKIDLGSSNSYINLVTVLENLFGCLGIGVAKEGKKCEYIIIYEDKDRDWMLVGDVPWQMFKESCKRLRIVKRSDATGFGLQQD 5E9B130584A75465 arfd_arath Auxin response factor 4 ARF4 MUF9.8 At5g60450 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEFDLNTEIAEVEEEENDDVGVGVGGGTRIDKGRLGISPSSSSSCSSGSSSSSSSTGSASSIYSELWHACAGPLTCLPKKGNVVVYFPQGHLEQDAMVSYSSPLEIPKFDLNPQIVCRVVNVQLLANKDTDEVYTQVTLLPLQEFSMLNGEGKEVKELGGEEERNGSSSVKRTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFAPLDYKQQRPSQELIAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFLRDEGGELRLGIRRAARPRNGLPDSIIEKNSCSNILSLVANAVSTKSMFHVFYSPRATHAEFVIPYEKYITSIRSPVCIGTRFRMRFEMDDSPERRCAGVVTGVCDLDPYRWPNSKWRCLLVRWDESFVSDHQERVSPWEIDPSVSLPHLSIQSSPRPKRPWAGLLDTTPPGNPITKRGGFLDFEESVRPSKVLQGQENIGSASPSQGFDVMNRRILDFAMQSHANPVLVSSRVKDRFGEFVDATGVNPACSGVMDLDRFPRVLQGQEICSLKSFPQFAGFSPAAAPNPFAYQANKSSYYPLALHGIRSTHVPYQNPYNAGNQSSGPPSRAINFGEETRKFDAQNEGGLPNNVTADLPFKIDMMGKQKGSELNMNASSGCKLFGFSLPVETPASKPQSSSKRICTKVHKQGSQVGRAIDLSRLNGYDDLLMELERLFNMEGLLRDPEKGWRILYTDSENDMMVVGDDPWHDFCNVVWKIHLYTKEEVENANDDNKSCLEQAALMMEASKSSSVSQPDSSPTITRV BF9D5056D1DD7A6F arfi_arath Auxin response factor 9 ARF9 T19F6.20 T32A16.150 At4g23980 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MANRGGEYLYDELWKLCAGPLVDVPQAQERVYYFPQGHMEQLEASTQQVDLNTMKPLFVLPPKILCNVMNVSLQAEKDTDEVYAQITLIPVGTEVDEPMSPDPSPPELQRPKVHSFSKVLTASDTSTHGGFSVLRKHATECLPPLDMTQQTPTQELVAEDVHGYQWKFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDTFVFLRGENGELRVGVRRANLQQSSMPSSVISSHSMHLGVLATARHATQTKTMFIVYYKPRTSQFIISLNKYLEAMSNKFSVGMRFKMRFEGEDSPERRYSGTVIGVKDCSPHWKDSKWRCLEVHWDEPASISRPNKVSPWEIEPFVNSENVPKSVMLKNKRPRQVSEVSALDVGITASNLWSSVLTQPHEFAQSCITSQWSSPQQCHRDANEDAKKSDWLNNSYSVSNVAKDSTLNDQMVSPVEQKKPETTANYRLFGIDLMSSSLAVPEEKTAPMRPINISKPTMDSHSDPKSEISKVSEEKKQEPAEGSPKEVQSKQSSSTRSRTKVQMQGVPVGRAVDLNALKGYNELIDDIEKLFDIKGELRSRNQWEIVFTDDEGDMMLVGDDPWPEFCNMVKRIFIWSKEEVKKMTPGNQLRMLLREVETTLTTTSKTDNHSN 6EBA72A9F8909C82 iaa17_arath Auxin-responsive protein IAA17 Indoleacetic acid-induced protein 17 Auxin response 3 IAA17 AXR3 At1g04250 F19P19.31 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MMGSVELNLRETELCLGLPGGDTVAPVTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA DIP protein P93830 original sequence version: null ECEA39207476581E arfa_arath Auxin response factor 1 ARF1 F23H11.7 At1g59750 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAASNHSSGKPGGVLSDALCRELWHACAGPLVTLPREGERVYYFPEGHMEQLEASMHQGLEQQMPSFNLPSKILCKVINIQRRAEPETDEVYAQITLLPELDQSEPTSPDAPVQEPEKCTVHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVATDLHNSEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLRGENEELRVGVRRHMRQQTNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEKRFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANSTPSSQPQPPQRNKRPRPPGLPSPATGPSGPVTPDGVWKSPADTPSSVPLFSPPAKAATFGHGGNKSFGVSIGSAFWPTNADSAAESFASAFNNESTEKKQTNGNVCRLFGFELVENVNVDECFSAASVSGAVAVDQPVPSNEFDSGQQSEPLNINQSDIPSGSGDPEKSSLRSPQESQSRQIRSCTKVHMQGSAVGRAIDLTRSECYEDLFKKLEEMFDIKGELLESTKKWQVVYTDDEDDMMMVGDDPWNEFCGMVRKIFIYTPEEVKKLSPKNKLAVNARMQLKADAEENGNTEGRSSSMAGSR 79DD3180C2091401 arfl_arath Auxin response factor 12 ARF12 F23M19.4 At1g34310 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MESGNVVNAQPELSGIIDGSKSYVYEQLWKLCAGPLCDIPKLGEKVYYFPQGHIELVETSTREELNELQPICDLPSKLQCRVIAIHLKVENNSDETYAEITLMPDTTQVVIPTQNENQFRPLVNSFTKVLTASDTSAHGGFFVPKKHAIECLPSLDMSQPLPAQELLAIDLHGNQWRFNHNYRGTPQRHLLTTGWNAFTTSKKLVAGDVIVFVRGETGELRVGIRRARHQQGNIPSSIVSIDCMRHGVVASAKHAFDNQCMFTVVYKPRSSKFIVSYDKFLDAVNNKFNVGSRFTMRLEGDDFSERRCFGTIIGVSDFSPHWKCSEWRSLEVQWDEFTSFPGPKKVSPWDIEHLMPAINVPRSFLLKNKRLREVNEIGSSSSHLLPPILTQGQENEQLSVASPMNISLRYRDATEDAMNPSKLLMSYPVQPMPKLNYNNQMVTEMEENITTKTGTNFRLFGVTLDTPPVIKDPIEEIGSEISKLTEGKKFGLSQTLRSPTEIQNKQFSSSRTCTKVQMQGVTIGRAVDLSVLNGYDQLILELEKLFDIKGQLQTRNQWEIAFTDSDEDKMLVGDDPWPEFCNMVKKIFIQKRR 01DCBAB5889B2ECA iaa9_arath Auxin-responsive protein IAA9 Indoleacetic acid-induced protein 9 IAA9 At5g65670 F6H11.210 MPA24.1 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSPEEELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVYTEKNWMFPEAAATQSVTKKDVPQNIPKGQSSTTNNSSSPPAAKAQIVGWPPVRSYRKNTLATTCKNSDEVDGRPGSGALFVKVSMDGAPYLRKVDLRSYTNYGELSSALEKMFTTFTLGQCGSNGAAGKDMLSETKLKDLLNGKDYVLTYEDKDGDWMLVGDVPWEMFIDVCKKLKIMKGCDAIGLAAAPRAMEKSKMRA F13BE50C222F6B42 iaa14_arath Auxin-responsive protein IAA14 IAA14 SLR1 Indoleacetic acid-induced protein 14 Protein SOLITARY ROOT dl3315c FCAALL.254 At4g14550 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MNLKETELCLGLPGGTETVESPAKSGVGNKRGFSETVDLKLNLQSNKQGHVDLNTNGAPKEKTFLKDPSKPPAKAQVVGWPPVRNYRKNVMANQKSGEAEEAMSSGGGTVAFVKVSMDGAPYLRKVDLKMYTSYKDLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKDGDWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNRS DIP protein Q38832 original sequence version: 90 A76A9F733538E372 arfj_arath Auxin response factor 10 ARF10 T1B3.13 At2g28350 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEQEKSLDPQLWHACAGSMVQIPSLNSTVFYFAQGHTEHAHAPPDFHAPRVPPLILCRVVSVKFLADAETDEVFAKITLLPLPGNDLDLENDAVLGLTPPSSDGNGNGKEKPASFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSAEPPVQTVIAKDIHGETWKFRHIYRGTPRRHLLTTGWSTFVNQKKLIAGDSIVFLRSESGDLCVGIRRAKRGGLGSNAGSDNPYPGFSGFLRDDESTTTTSKLMMMKRNGNNDGNAAATGRVRVEAVAEAVARAACGQAFEVVYYPRASTPEFCVKAADVRSAMRIRWCSGMRFKMAFETEDSSRISWFMGTVSAVQVADPIRWPNSPWRLLQVAWDEPDLLQNVKRVSPWLVELVSNMPTIHLSPFSPRKKIRIPQPFEFPFHGTKFPIFSPGFANNGGGESMCYLSNDNNNAPAGIQGARQAQQLFGSPSPSLLSDLNLSSYTGNNKLHSPAMFLSSFNPRHHHYQARDSENSNNISCSLTMGNPAMVQDKKKSVGSVKTHQFVLFGQPILTEQQVMNRKRFLEEEAEAEEEKGLVARGLTWNYSLQGLETGHCKVFMESEDVGRTLDLSVIGSYQELYRKLAEMFHIEERSDLLTHVVYRDANGVIKRIGDEPFSDFMKATKRLTIKMDIGGDNVRKTWITGIRTGENGIDASTKTGPLSIFA 6D3002534DC6F9E7 iaa19_arath Auxin-responsive protein IAA19 Indoleacetic acid-induced protein 19 Protein MASSUGU 2 IAA19 MSG2 At3g15540 MJK13.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEKEGLGLEITELRLGLPGRDVAEKMMKKRAFTEMNMTSSGSNSDQCESGVVSSGGDAEKVNDSPAAKSQVVGWPPVCSYRKKNSCKEASTTKVGLGYVKVSMDGVPYLRKMDLGSSQGYDDLAFALDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFLESCKRLRIMKRSDATGFGLQPRGVDE DIP protein O24409 original sequence version: 103 84B332B780132B53 iaa12_arath Auxin-responsive protein IAA12 Indoleacetic acid-induced protein 12 Protein BODENLOS IAA12 BDL At1g04550 T1G11.20 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MRGVSELEVGKSNLPAESELELGLGLSLGGGAWKERGRILTAKDFPSVGSKRSAESSSHQGASPPRSSQVVGWPPIGLHRMNSLVNNQAMKAARAEEGDGEKKVVKNDELKDVSMKVNPKVQGLGFVKVNMDGVGIGRKVDMRAHSSYENLAQTLEEMFFGMTGTTCREKVKPLRLLDGSSDFVLTYEDKEGDWMLVGDVPWRMFINSVKRLRIMGTSEASGLAPRRQEQKDRQRNNPV BBAADA3E98B222CA iaa18_arath Auxin-responsive protein IAA18 IAA18 Indoleacetic acid-induced protein 18 T14L22.14 At1g51950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEGYSRNGEISPKLLDLMIPQERRNWFHDEKNSVFKTEEKKLELKLGPPGEEDDDESMIRHMKKEPKDKSILSLAGKYFSPSSTKTTSHKRTAPGPVVGWPPVRSFRKNLASGSSSKLGNDSTTSNGVTLKNQKCDAAAKTTEPKRQGGMFVKINMYGVPIGRKVDLSAHNSYEQLSFTVDKLFRGLLAAQRDFPSSIEDEKPITGLLDGNGEYTLTYEDNEGDKMLVGDVPWQMFVSSVKRLRVIKTSEISSALTYGNGKQEKMRR DIP protein O24408 original sequence version: 95 F1DC7E50172B7B10 arfr_arath Auxin response factor 18 ARF18 F15G16.220 At3g61830 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASVEGDDDFGSSSSRSYQDQLYTELWKVCAGPLVEVPRAQERVFYFPQGHMEQLVASTNQGINSEEIPVFDLPPKILCRVLDVTLKAEHETDEVYAQITLQPEEDQSEPTSLDPPIVGPTKQEFHSFVKILTASDTSTHGGFSVLRKHATECLPSLDMTQATPTQELVTRDLHGFEWRFKHIFRGQPRRHLLTTGWSTFVSSKRLVAGDAFVFLRGENGDLRVGVRRLARHQSTMPTSVISSQSMHLGVLATASHAVRTTTIFVVFYKPRISQFIVGVNKYMEAIKHGFSLGTRFRMRFEGEESPERIFTGTIVGSGDLSSQWPASKWRSLQVQWDEPTTVQRPDKVSPWEIEPFLATSPISTPAQQPQSKCKRSRPIEPSVKTPAPPSFLYSLPQSQDSINASLKLFQDPSLERISGGYSSNNSFKPETPPPPTNCSYRLFGFDLTSNSPAPIPQDKQPMDTCGAAKCQEPITPTSMSEQKKQQTSRSRTKVQMQGIAVGRAVDLTLLKSYDELIDELEEMFEIQGQLLARDKWIVVFTDDEGDMMLAGDDPWNEFCKMAKKIFIYSSDEVKKMTTKLKISSSLENEEYGNESFENRSRG DIP protein Q9C5W9 original sequence version: null EC299D42B1A1C0BD arf1-iaa19 2 17 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 3C iaa19-arf4-1 2 17 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 3C iaa19-arf5-1 2 5 unspecified role unspecified role prey prey ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3C iaa19-arf6-1 2 6 unspecified role unspecified role prey prey ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3C iaa19-arf9-1 2 10 unspecified role unspecified role prey prey ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 17 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3C arf1-iaa12 1 18 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association author score author-based confidence author score 0.044 3A arf1-iaa18-3 1 19 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association author score author-based confidence author score 0.247 3A arf1-iaa28-2 1 7 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association author score author-based confidence author score 0.735 3A arf4-iaa6-2 1 9 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association author score author-based confidence author score 0.292 3A arf4-iaa9-2 1 9 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association author score author-based confidence author score 0.179 3A arf4-iaa18-2 1 19 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association author score author-based confidence author score 0.124 3A arf4-iaa19-2 1 17 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association author score author-based confidence author score 0.412 3A arf4-iaa28-2 1 7 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association author score author-based confidence author score 1.026 3A arf5-iaa28-3 1 5 unspecified role unspecified role neutral component neutral component cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association author score author-based confidence author score 1 3A arf5-iaa19-3 1 17 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association author score author-based confidence author score 0.594 3A arf1-iaa13 1 3 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association author score author-based confidence author score 0.044 3A arf5-iaa1-4 1 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component n terminal luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association author score author-based confidence author score 1 3A arf5-iaa6 1 8 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association author score author-based confidence author score 1 3A arf5-iaa9 1 14 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association author score author-based confidence author score 1 3A arf5-iaa12 1 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association author score author-based confidence author score 1 3A arf5-iaa13 1 3 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association author score author-based confidence author score 1 3A arf5-iaa14 1 15 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association author score author-based confidence author score 1 3A arf5-iaa17 1 11 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association author score author-based confidence author score 1 3A arf5-iaa18 1 19 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association author score author-based confidence author score 1 3A arf6-iaa6 1 8 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association author score author-based confidence author score 1 3A arf6-iaa28 1 6 unspecified role unspecified role neutral component neutral component cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association author score author-based confidence author score 1 3A arf9-iaa6 1 8 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association author score author-based confidence author score 1 3A arf9-iaa19 1 17 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A arf10-iaa28 1 16 unspecified role unspecified role neutral component neutral component cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A arf12-iaa28 1 7 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role neutral component neutral component cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 3A arf18-iaa28 1 7 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A arf18-iaa19 1 20 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 17 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A arf9-iaa28 1 10 unspecified role unspecified role neutral component neutral component cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A arf18-iaa18 1 20 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 19 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A arf18-iaa13 1 20 unspecified role unspecified role neutral component neutral component cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A arf18-iaa12 1 20 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 18 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A arf18-iaa9 1 20 unspecified role unspecified role neutral component neutral component cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A arf18-iaa6 1 20 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain cterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component nterminal-luciferase tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A arf1-arf1-2 1 12 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role neutral component neutral component flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4A arf1-arf4 1 9 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 256 254 physical association physical association 4A arf1-arf5 1 5 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4A arf1-arf6 1 6 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 267 270 physical association physical association 4A arf1-arf9 1 10 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4A arf1-arf10 1 12 unspecified role unspecified role neutral component neutral component flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 16 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 282 285 physical association physical association 4A arf1-arf12 1 13 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 289 291 physical association physical association 4A arf4-arf4 1 9 unspecified role unspecified role neutral component neutral component flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined flucn tag tag certain certain sequence position certain certain certain sequence position certain 296 299 physical association physical association 4A arf4-arf5 1 9 unspecified role unspecified role neutral component neutral component flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4A arf4-arf6 1 6 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 310 312 physical association physical association 4A arf4-arf9 1 10 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucn tag tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role neutral component neutral component flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4A arf4-arf10 1 16 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4A arf4-arf12 1 9 unspecified role unspecified role neutral component neutral component flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 334 331 physical association physical association 4A arf4-arf18 1 20 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 337 340 physical association physical association 4A arf5-arf18 1 5 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4A arf5-arf12 1 13 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 354 352 physical association physical association 4A arf5-arf10 1 16 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 5 unspecified role unspecified role neutral component neutral component flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 362 359 physical association physical association 4A arf5-arf9 1 10 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 368 365 physical association physical association 4A arf5-arf6 1 5 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4A arf5-arf5 1 5 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4A arf1-arf18 1 12 unspecified role unspecified role neutral component neutral component flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 20 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 390 387 physical association physical association 4A arf6-arf12 1 6 unspecified role unspecified role neutral component neutral component flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 396 394 physical association physical association 4A arf6-arf10 1 16 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 401 403 physical association physical association 4A arf9-arf9 1 10 unspecified role unspecified role neutral component neutral component flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4A arf9-arf10 1 10 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4A arf9-arf12 1 13 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role neutral component neutral component flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4A arf9-arf18 1 10 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 432 428 physical association physical association 4A arf10-arf18 1 16 unspecified role unspecified role neutral component neutral component flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 20 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4A arf10-arf12 1 16 unspecified role unspecified role neutral component neutral component flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4A arf10-arf10 1 16 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 16 unspecified role unspecified role neutral component neutral component flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 453 450 physical association physical association 4A arf12-arf12 1 13 unspecified role unspecified role neutral component neutral component flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 13 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 457 460 physical association physical association 4A arf12-arf18 1 20 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4A arf18-arf18 1 20 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 20 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4A arf6-arf6 1 6 unspecified role unspecified role neutral component neutral component flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4A arf6-arf9-1 1 6 unspecified role unspecified role neutral component neutral component flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain nlucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 487 485 physical association physical association 4A arf18-arf6 1 20 unspecified role unspecified role neutral component neutral component flucn tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role neutral component neutral component ctd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain flucc tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 492 494 physical association physical association 4A