MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The structural basis of Edc3- and Scd6-mediated activation of the Dcp1:Dcp2 mRNA decapping complex. The structural basis of Edc3- and Scd6-mediated activation of the Dcp1:Dcp2 mRNA decapping complex. EMBO J. (0261-4189) 2012 imex curation Fromm SA., Truffault V., Kamenz J., Braun JE., Hoffmann NA., Izaurralde E., Sprangers R. Only protein-protein interactions in vitro In vitro pull down pull down weight by staining molecular weight estimation by staining weight by staining Fromm SA., Truffault V., Kamenz J., Braun JE., Hoffmann NA., Izaurralde E., Sprangers R. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation The structural basis of Edc3- and Scd6-mediated activation of the Dcp1:Dcp2 mRNA decapping complex. The structural basis of Edc3- and Scd6-mediated activation of the Dcp1:Dcp2 mRNA decapping complex. EMBO J. (0261-4189) 2012 imex curation Fromm SA., Truffault V., Kamenz J., Braun JE., Hoffmann NA., Izaurralde E., Sprangers R. Only protein-protein interactions schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Fromm SA., Truffault V., Kamenz J., Braun JE., Hoffmann NA., Izaurralde E., Sprangers R. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation The structural basis of Edc3- and Scd6-mediated activation of the Dcp1:Dcp2 mRNA decapping complex. The structural basis of Edc3- and Scd6-mediated activation of the Dcp1:Dcp2 mRNA decapping complex. EMBO J. (0261-4189) 2012 imex curation Fromm SA., Truffault V., Kamenz J., Braun JE., Hoffmann NA., Izaurralde E., Sprangers R. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Fromm SA., Truffault V., Kamenz J., Braun JE., Hoffmann NA., Izaurralde E., Sprangers R. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation dcp1_schpo mRNA-decapping enzyme subunit 1 dcp1 SPBC3B9.21 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR DD593F646C61EEC0 mint DD593F646C61EEC0 dcp2_schpo mRNA decapping complex subunit 2 dcp2 SPAC19A8.12 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSFTNATFSQVLDDLSARFILNLPAEEQSSVERLCFQIEQAHWFYEDFIRAQNDQLPSLGLRVFSAKLFAHCPLLWKWSKVHEEAFDDFLRYKTRIPVRGAIMLDMSMQQCVLVKGWKASSGWGFPKGKIDKDESDVDCAIREVYEETGFDCSSRINPNEFIDMTIRGQNVRLYIIPGISLDTRFESRTRKEISKIEWHNLMDLPTFKKNKPQTMKNKFYMVIPFLAPLKKWIKKRNIANNTTKEKNISVDVDADASSQLLSLLKSSTAPSDLATPQPSTFPQPPVESHSSFDIKQKILHLLNEGNEPKSPIQLPPVSNLPLNPPIQSSNSRLSHDNNSFDPFAYLGLDPKNPSASFPRVVSQNNMLTNKPVLNNHFQQSMYSNLLKDQNSVQHLFAASDMPSPMELPSPSTVYHQVFYPPTSTSVSSYGLGKTPQPAYGSSSPYVNGHQTQQISSLPPFQSQTQFLARNSDNSGQSYNSEGDSNSKRLLSMLSQQDTTPSSSTLSKEANVQLANLFLTPNSLETKKFSDNSQGEEISDNLHGESCNNPNANSVHSAQLLQALLHPSATETKEETPKKTSDSLSLLTLLKSGLPTPANDLQNKSQNNERKASSQVKELEVKNYSKSTDLLKKTLRIPRNDEPLEAANQFDLLKVSPQQKSEVPPKRNELSQSKLKNRKKKENSETNKNHVDMSPGFVKILKRSPLADQKKEDTQESDFKGSDDHFLSYLQSVVSSNSNGLH B405257B706BC5C0 B405257B706BC5C0 sum2_schpo Protein sum2 sum2 SPBC800.09 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MTEFIGSRISLISKSDIRYVGILQDINSQDSTLALKHVRWCGTEGRKQDPSQEIPPSDNVFDYIVFRGSDVKDLRIEEPATTPSAPPVQPPNDPAIIGSNSGQYNWNQAQTAQPPQPVQPNPYGAPYQQAPPAGAPYYMYPNAPAQFVPPGGLPLGTPLDASTPAVPYYGAPDQQQMGQRPEFAQNVSQGFAGQAPYNVRPGYGMPSNQKPPNFAPGMPAPGPTAVSASPSLQSMPPTNGVIPGAQPSIEASIEKESTSIRNSTVTNDRVVNTTVDVSQSQTVETSGPSKEVPTTQPDASAAKPRTEFDFQTANQKFQSMKDDLLKGKNDEEAEEFYKPKQSFFDNISCESKEKGMEAADRRALRDRERSLNMETFGVAGSGNRGRRGRGRGRGGRGRGRGYARNQYNQYRNSNGSQPRAQPANDQ 3E97B4263D2FAF4D edc3_schpo Enhancer of mRNA-decapping protein 3 edc3 SPBC18E5.11c SPBC23G7.01c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSVADFYGSNVEVLLNNDSKARGVITNFDSSNSILQLRLANDSTKSIVTKDIKDLRILPKNEIMPKNGTKSPSTNSTKLKSAETYSSKNKWSMDCDEEFDFAANLEKFDKKQVFAEFREKDKKDPAKLLVSHNKSPNRNYHHKQNVLGPSVKDEFVDLPSAGSQINGIDAVLSSSSNGHVTPGSKKGSRETLKKKPFVDENIPAELHTTTGDILKPITPEQLSQGIALAIAKTSTDIVVENAAQLLSQFVFSVLGGHKRLSSRNHNSQPLVCILVGSHDHASAAVAAGRRLCAIGIKVVLRLLTPFNVDNRQLLMFQAAGGYIPTENFDQFLNKLTSPIELVVDVLTGFHPSIDKNSHALIQWANDLNVLILSVDIPSGYTVQKKNTAILPKWTLALGAVTTTLAQAALVKQAAGVSVFVGNLGTGSQTWAELGILESQVTGQYLAQISCTSTN mint F488C398D2550275 dcp2-edc3-1 3 dcp2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain EDC3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction mint f1e f2a f2b sf3 sf2 st1b st1c dcp2-edc3-2 3 dcp2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain EDC3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f3c mint dcp2-edc3-3 3 dcp2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain EDC3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction mint f3c sf6a sf6b dcp2-edc3-4 3 dcp2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain EDC3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f3c mint dcp2-sum2 3 Scd6 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain dcp2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f4b mint dcp2-sum2-1 3 Scd6 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain dcp2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f4b mint dcp2-sum2-2 3 Scd6 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain dcp2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f4b mint dcp2-sum2-3 3 dcp2 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain Scd6 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction mint f4b sf7 dcp1-dcp1 1 dcp2 5 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified EDC3 7 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified dcp1 4 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined dcp1 4 weight by staining molecular weight estimation by staining weight by staining predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified physical association physical association f3d mint However, when full-length (FL) Edc3 was added to the mixture of His6 Dcp1:Dcp2 and Dcp1:Dcp2 (Figure 3D, lane 5), the Ni-NTA purified complex did contain untagged Dcp1 (Figure 3D, lane 6). This clearly shows that untagged Dcp1 co-purifies with His6-tagged Dcp1 in the presence of Dcp2 and FL Edc3. This result can be explained by the formation of a complex that contains His6 Dcp1:Dcp2 coupled to an untagged Dcp1:Dcp2 complex through a FL Edc3 dimer. dcp1-dcp2-1 2 dcp2 5 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined dcp1 4 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization f6a mint Dcp1 mCherry and Dcp2 GFP localized to the same cytoplasmic foci, but this localization was abolished in all three Dcp2 truncations and both Dcp1 as well as the truncated Dcp2 proteins were homogenously distributed throughout the cytoplasm (Figure 6A). Additionally, we observed that Dcp2 D290 741 GFP and Dcp2 D244 741 GFP were no longer excluded from the nucleus (Figure 6A and B). These changes in localization were not caused by differences in Dcp2 abundance, as FL Dcp2 and all truncation mutants were expressed to similar levels (Supplementary Figure S8C). dcp2-edc3-5 2 dcp2 5 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined EDC3 7 tag fluorescence tag visualisation by fluorescence tag fluorescence predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization f6b mint