MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it LRPPRC is necessary for polyadenylation and coordination of translation of mitochondrial mRNAs. LRPPRC is necessary for polyadenylation and coordination of translation of mitochondrial mRNAs. EMBO J. (0261-4189) 2012 imex curation Ruzzenente B., Metodiev MD., Wredenberg A., Bratic A., Park CB., Cámara Y., Milenkovic D., Zickermann V., Wibom R., Hultenby K., Erdjument-Bromage H., Tempst P., Brandt U., Stewart JB., Gustafsson CM., Larsson NG. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip predetermined predetermined participant predetermined Ruzzenente B., Metodiev MD., Wredenberg A., Bratic A., Park CB., Cámara Y., Milenkovic D., Zickermann V., Wibom R., Hultenby K., Erdjument-Bromage H., Tempst P., Brandt U., Stewart JB., Gustafsson CM., Larsson NG. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation LRPPRC is necessary for polyadenylation and coordination of translation of mitochondrial mRNAs. LRPPRC is necessary for polyadenylation and coordination of translation of mitochondrial mRNAs. EMBO J. (0261-4189) 2012 imex curation Ruzzenente B., Metodiev MD., Wredenberg A., Bratic A., Park CB., Cámara Y., Milenkovic D., Zickermann V., Wibom R., Hultenby K., Erdjument-Bromage H., Tempst P., Brandt U., Stewart JB., Gustafsson CM., Larsson NG. Only protein-protein interactions in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot Ruzzenente B., Metodiev MD., Wredenberg A., Bratic A., Park CB., Cámara Y., Milenkovic D., Zickermann V., Wibom R., Hultenby K., Erdjument-Bromage H., Tempst P., Brandt U., Stewart JB., Gustafsson CM., Larsson NG. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation LRPPRC is necessary for polyadenylation and coordination of translation of mitochondrial mRNAs. LRPPRC is necessary for polyadenylation and coordination of translation of mitochondrial mRNAs. EMBO J. (0261-4189) 2012 imex curation Ruzzenente B., Metodiev MD., Wredenberg A., Bratic A., Park CB., Cámara Y., Milenkovic D., Zickermann V., Wibom R., Hultenby K., Erdjument-Bromage H., Tempst P., Brandt U., Stewart JB., Gustafsson CM., Larsson NG. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Ruzzenente B., Metodiev MD., Wredenberg A., Bratic A., Park CB., Cámara Y., Milenkovic D., Zickermann V., Wibom R., Hultenby K., Erdjument-Bromage H., Tempst P., Brandt U., Stewart JB., Gustafsson CM., Larsson NG. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation slirp_human SRA stem-loop-interacting RNA-binding protein, mitochondrial SLIRP C14orf156 DC23 DC50 PD04872 protein protein human Homo sapiens Human MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQTSDDEKKDF 8BDCB6EA244F17B8 slirp_mouse SRA stem-loop-interacting RNA-binding protein, mitochondrial Slirp protein protein mouse Mus musculus Mouse MAASAIKGLSALRSSTGRPIAFVRKIPWTAAASELREHFAQFGHVRRCTVPFDKETGFHRGMGWVQFSSQEELQNALQQEHHIIDGVKIHVQAQRAKALHGAQTSDEERFLR mint RNA-binding protein that acts as a nuclear receptor corepressor. Probably acts by binding the SRA RNA, and repressing the SRA-mediated nuclear receptor coactivation. Binds the STR7 loop of SRA RNA. Also able to repress glucocorticoid (GR), androgen (AR), thyroid (TR) and VDR-mediated transactivation 3A03B372E1DA05DB q99kf9_mouse Lrpprc protein protein mouse Mus musculus Mouse MREAARLCVCLCVCVSVCVSVCVSVCVCLCVYMRAHMPMSKCYF mint C49523A82D448591 lpprc_human Leucine-rich PPR motif-containing protein, mitochondrial 130 kDa leucine-rich protein GP130 LRPPRC LRP130 protein protein human Homo sapiens Human MAALLRSARWLLRAGAAPRLPLSLRLLPGGPGRLHAASYLPAARAGPVAGGLLSPARLYAIAAKEKDIQEESTFSSRKISNQFDWALMRLDLSVRRTGRIPKKLLQKVFNDTCRSGGLGGSHALLLLRSCGSLLPELKLEERTEFAHRIWDTLQKLGAVYDVSHYNALLKVYLQNEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNVGDIEGASKILGFMKTKDLPVTEAVFSALVTGHARAGDMENAENILTVMRDAGIEPGPDTYLALLNAYAEKGDIDHVKQTLEKVEKSELHLMDRDLLQIIFSFSKAGYPQYVSEILEKVTCERRYIPDAMNLILLLVTEKLEDVALQILLACPVSKEDGPSVFGSFFLQHCVTMNTPVEKLTDYCKKLKEVQMHSFPLQFTLHCALLANKTDLAKALMKAVKEEGFPIRPHYFWPLLVGRRKEKNVQGIIEILKGMQELGVHPDQETYTDYVIPCFDSVNSARAILQENGCLSDSDMFSQAGLRSEAANGNLDFVLSFLKSNTLPISLQSIRSSLLLGFRRSMNINLWSEITELLYKDGRYCQEPRGPTEAVGYFLYNLIDSMSDSEVQAKEEHLRQYFHQLEKMNVKIPENIYRGIRNLLESYHVPELIKDAHLLVESKNLDFQKTVQLTSSELESTLETLKAENQPIRDVLKQLILVLCSEENMQKALELKAKYESDMVTGGYAALINLCCRHDKVEDALNLKEEFDRLDSSAVLDTGKYVGLVRVLAKHGKLQDAINILKEMKEKDVLIKDTTALSFFHMLNGAALRGEIETVKQLHEAIVTLGLAEPSTNISFPLVTVHLEKGDLSTALEVAIDCYEKYKVLPRIHDVLCKLVEKGETDLIQKAMDFVSQEQGEMVMLYDLFFAFLQTGNYKEAKKIIETPGIRARSARLQWFCDRCVANNQVETLEKLVELTQKLFECDRDQMYYNLLKLYKINGDWQRADAVWNKIQEENVIPREKTLRLLAEILREGNQEVPFDVPELWYEDEKHSLNSSSASTTEPDFQKDILIACRLNQKKGAYDIFLNAKEQNIVFNAETYSNLIKLLMSEDYFTQAMEVKAFAETHIKGFTLNDAANSRLIITQVRRDYLKEAVTTLKTVLDQQQTPSRLAVTRVIQALAMKGDVENIEVVQKMLNGLEDSIGLSKMVFINNIALAQIKNNNIDAAIENIENMLTSENKVIEPQYFGLAYLFRKVIEEQLEPAVEKISIMAERLANQFAIYKPVTDFFLQLVDAGKVDDARALLQRCGAIAEQTPILLLFLLRNSRKQGKASTVKSVLELIPELNEKEEAYNSLMKSYVSEKDVTSAKALYEHLTAKNTKLDDLFLKRYASLLKYAGEPVPFIEPPESFEFYAQQLRKLRENSS 61AB0C8BF8A972E6 rt15_mouse 28S ribosomal protein S15, mitochondrial Mrps15 Rpms15 protein protein mouse Mus musculus Mouse MLRAAWRALSSVRAQAVTRAPVPALRGGSSASLLSARCGLQPPSLLRAARAYAAVQKPVQPKQDDEPPSSAFIKEYKDIIPNIEKVDDVVKRILSLEMASRKEKLKIKQEQLMNKIVENPEDSRTLEAQIIALTVRIRNYEEHMQKHRKDKAHKRHLLMSIDRRKKLLKILRQTNYDVFEKTCKELGVEYTLPPLHFQKVHRRFLAKKALCIRVYQEVQKLKKQKRALKAAAAAAKKEKNEGVPENPSNAVPEKTQVN mint homomint 98FF04FA2EE78D96 rm13_mouse 39S ribosomal protein L13, mitochondrial Mrpl13 protein protein mouse Mus musculus Mouse MSSFSRAPQQWATFARMWYLLDGKMQPPGKLAVIASNKLQGLNKPVYHQLSDCGDHVVIINTRHIAFSGNKWEQKVYSSHTGYPGGFRQVTAAQLHRKDPVAIVKLAIYGMLPKNLHRRTMMQRLHLFPDEDIPEDILKNLVEELPQPRRVPKRLDEYTQEEIEAFPRVWTPPDDFRM mint homomint A103D2D880EE573B lrpprc-slirp 3 LRPPRC 6 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level SLIRP 5 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association F5A mint mrpl13-mrps15 2 MRPL13 9 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level MRPS15 8 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization homomint mint F6C lrpprc-slirp-1 1 SLIRP 4 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level LRPPRC 7 anti tag western anti tag western blot anti tag western predetermined predetermined participant predetermined unspecified role unspecified role bait bait subcellular prep subcellular preparation subcellular prep over-expressed over expressed level over-expressed flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association homomint mint sf4b