mpidb The Microbial Protein Interaction Database The same periplasmic ExbD residues mediate in vivo interactions between ExbD homodimers and ExbD-TonB heterodimers. The same periplasmic ExbD residues mediate in vivo interactions between ExbD homodimers and ExbD-TonB heterodimers. J. Bacteriol. (0021-9193) 2011 imex curation Ollis A.A., Postle K. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli crosslink cross-linking study crosslink predetermined predetermined participant predetermined Ollis A.A., Postle K. Accepted 2012-DEC-06 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation exbd_ecoli Biopolymer transport protein ExbD exbD JW2973 b3005 protein protein ecoli Escherichia coli (strain K12) MAMHLNENLDDNGEMHDINVTPFIDVMLVLLIIFMVAAPLATVDVKVNLPASTSTPQPRPEKPVYLSVKADNSMFIGNDPVTDETMITALNALTEGKKDTTIFFRADKTVDYETLMKVMDTLHQAGYLKIGLVGEETAKAK DIP protein P0ABV2 original sequence version: 70 25A539A2FAEB9F6C exbb_ecoli Biopolymer transport protein ExbB JW2974 b3006 exbB protein protein ecoli Escherichia coli (strain K12) MGNNLMQTDLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKREQQLLAEARSLNQANDIAADFGSKSLSLHLLNEAQNELELSEGSDDNEGIKERTSFRLERRVAAVGRQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLVAAIPAVVIYNVFARQIGGFKAMLGDVAAQVLLLQSRDLDLEASAAAHPVRVAQKLRAG DIP protein P0ABU7 original sequence version: 37 DIP protein P0ABU7 original sequence version: 72 CEB63893A80BA71F tonb_ecoli Protein TonB tonB exbA JW5195 b1252 protein protein ecoli Escherichia coli (strain K12) MTLDLPRRFPWPTLLSVCIHGAVVAGLLYTSVHQVIELPAPAQPISVTMVTPADLEPPQAVQPPPEPVVEPEPEPEPIPEPPKEAPVVIEKPKPKPKPKPKPVKKVQEQPKRDVKPVESRPASPFENTAPARLTSSTATAATSKPVTSVASGPRALSRNQPQYPARAQALRIEGQVKVKFDVTPDGRVDNVQILSAKPANMFEREVKNAMRRWRYEPGKPGSGIVVNILFKINGTTEIQ DIP protein P02929 original sequence version: 99 3B59F39D791AE815 exbd-exbd 1 2 unspecified role unspecified role unspecified role unspecified role P0ABV2:p.Val110Cys P0ABV2-110-110 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain V C Wed May 02 19:28:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val110cys' Tue Jun 30 19:51:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val110Cys' P0ABV2:p.Lys98Cys P0ABV2-98-98 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain K C Wed May 02 19:25:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys98cys' Tue Jun 30 16:09:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys98Cys' P0ABV2:p.Asp111Cys P0ABV2-111-111 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain D C Wed May 02 15:55:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp111cys' Tue Jun 30 18:55:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp111Cys' P0ABV2:p.Asp99Cys P0ABV2-99-99 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain D C Wed May 02 16:53:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp99cys' Tue Jun 30 20:04:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp99Cys' P0ABV2:p.Tyr112Cys P0ABV2-112-112 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain Y C Wed May 02 19:54:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr112cys' Tue Jun 30 18:16:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr112Cys' P0ABV2:p.Glu113Cys P0ABV2-113-113 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain E C Wed May 02 15:14:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu113cys' Tue Jun 30 19:45:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu113Cys' P0ABV2:p.Asp120Cys P0ABV2-120-120 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain D C Wed May 02 17:17:45 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp120cys' Tue Jun 30 19:36:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp120Cys' P0ABV2:p.Met116Cys P0ABV2-116-116 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain M C Wed May 02 19:44:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met116cys' Tue Jun 30 18:14:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met116Cys' P0ABV2:p.Gly96Cys P0ABV2-96-96 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain G C Wed May 02 17:43:09 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly96cys' Tue Jun 30 19:26:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly96Cys' P0ABV2:p.Ile102Cys P0ABV2-102-102 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain I C Wed May 02 18:42:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile102cys' Tue Jun 30 16:33:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile102Cys' P0ABV2:p.Thr109Cys P0ABV2-109-109 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain T C Wed May 02 15:23:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr109cys' Tue Jun 30 16:23:00 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr109Cys' P0ABV2:p.Lys108Cys P0ABV2-108-108 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain K C Wed May 02 15:47:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys108cys' Tue Jun 30 19:19:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys108Cys' P0ABV2:p.Asp107Cys P0ABV2-107-107 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain D C Wed May 02 19:05:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp107cys' Tue Jun 30 19:30:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp107Cys' P0ABV2:p.Glu95Cys P0ABV2-95-95 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain E C Wed May 02 20:04:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu95cys' Tue Jun 30 17:32:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu95Cys' P0ABV2:p.Ala92Cys P0ABV2-92-92 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain A C Wed May 02 19:33:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala92cys' Tue Jun 30 15:46:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala92Cys' physical association physical association figure 3, 4 Oxidizing agent CuoP After treatment with oxidising agent, only 3 substitutions, K97C, T114C, and K117C, still showed no homodimer formation. For E95C, G96C, D99C, and I102C, homodimer levels remained unchanged after CuoP treatment. Significant increases in homodimers were observed for T109C - E113C, L115C, and M116C. exbd-p02929 1 2 unspecified role unspecified role unspecified role unspecified role P0ABV2:p.Met116Cys P0ABV2-116-116 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain M C Wed May 02 16:26:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met116cys' Tue Jun 30 17:16:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met116Cys' P0ABV2:p.Lys108Cys P0ABV2-108-108 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain K C Wed May 02 19:45:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys108cys' Tue Jun 30 16:09:59 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys108Cys' P0ABV2:p.Glu113Cys P0ABV2-113-113 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain E C Wed May 02 16:40:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu113cys' Tue Jun 30 17:18:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu113Cys' P0ABV2:p.Ile102Cys P0ABV2-102-102 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain I C Wed May 02 18:33:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile102cys' Tue Jun 30 19:37:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile102Cys' P0ABV2:p.Tyr112Cys P0ABV2-112-112 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain Y C Wed May 02 17:10:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr112cys' Tue Jun 30 18:42:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr112Cys' P0ABV2:p.Asp120Cys P0ABV2-120-120 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain D C Wed May 02 19:07:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp120cys' Tue Jun 30 18:48:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp120Cys' P0ABV2:p.Val110Cys P0ABV2-110-110 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain V C Wed May 02 16:33:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val110cys' Tue Jun 30 15:39:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val110Cys' P0ABV2:p.Asp107Cys P0ABV2-107-107 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain D C Wed May 02 18:30:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp107cys' Tue Jun 30 19:49:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp107Cys' P0ABV2:p.Asp111Cys P0ABV2-111-111 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain D C Wed May 02 18:48:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp111cys' Tue Jun 30 16:31:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp111Cys' P0ABV2:p.Ala92Cys P0ABV2-92-92 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain A C Wed May 02 16:47:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala92cys' Tue Jun 30 19:46:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala92Cys' P0ABV2:p.Gly96Cys P0ABV2-96-96 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain G C Wed May 02 16:59:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly96cys' Tue Jun 30 18:50:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly96Cys' P0ABV2:p.Thr109Cys P0ABV2-109-109 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain T C Wed May 02 15:25:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr109cys' Tue Jun 30 17:46:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr109Cys' 4 unspecified role unspecified role unspecified role unspecified role region P02929-18-150 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association figure 6 exbb-exbd 1 3 unspecified role unspecified role unspecified role unspecified role 2 unspecified role unspecified role unspecified role unspecified role P0ABV2:p.Met116Cys P0ABV2-116-116 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain M C Wed May 02 15:54:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'met116cys' Tue Jun 30 15:35:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Met116Cys' P0ABV2:p.Asp25Asn P0ABV2-25-25 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain D N Wed May 02 16:36:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp25asn' Tue Jun 30 18:29:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp25Asn' P0ABV2:p.Lys108Cys P0ABV2-107-107 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain K C Wed May 02 15:44:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys108cys' Tue Jun 30 20:14:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys108Cys' P0ABV2:p.Glu113Cys P0ABV2-113-113 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain E C Wed May 02 19:21:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu113cys' Tue Jun 30 16:18:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu113Cys' P0ABV2:p.Tyr112Cys P0ABV2-112-112 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain Y C Wed May 02 18:23:47 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr112cys' Tue Jun 30 15:46:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr112Cys' physical association physical association figure 4