InnateDB InnateDB The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. Nat. Immunol. (1529-2908) 2011 imex curation Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. ttan@nhri.org.tw 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Accepted 2012-JAN-13 by ORCHARD 14-Mar-2012: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. Nat. Immunol. (1529-2908) 2011 imex curation Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. ttan@nhri.org.tw 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Accepted 2012-JAN-13 by ORCHARD 14-Mar-2012: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. Nat. Immunol. (1529-2908) 2011 imex curation Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. ttan@nhri.org.tw 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-el4 Mus musculus el4 Mouse ascites lymphoma lymphoblast line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Accepted 2012-JAN-13 by ORCHARD 14-Mar-2012: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. Nat. Immunol. (1529-2908) 2011 imex curation Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. ttan@nhri.org.tw 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay western blot western blot Immuno blot Immuno blot Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Accepted 2012-JAN-13 by ORCHARD 14-Mar-2012: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. Nat. Immunol. (1529-2908) 2011 imex curation Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. ttan@nhri.org.tw 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Accepted 2012-JAN-13 by ORCHARD 14-Mar-2012: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. Nat. Immunol. (1529-2908) 2011 imex curation Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. ttan@nhri.org.tw 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions human-j-tag Homo sapiens T cell j-tag Human T cells anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Accepted 2012-JAN-13 by ORCHARD 14-Mar-2012: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. Nat. Immunol. (1529-2908) 2011 imex curation Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. ttan@nhri.org.tw 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Accepted 2012-JAN-13 by ORCHARD 14-Mar-2012: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. Nat. Immunol. (1529-2908) 2011 imex curation Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. ttan@nhri.org.tw 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Accepted 2012-JAN-13 by ORCHARD Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. Nat. Immunol. (1529-2908) 2011 imex curation Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. ttan@nhri.org.tw 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Accepted 2012-JAN-13 by ORCHARD 14-Mar-2012: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. The kinase GLK controls autoimmunity and NF-κB signaling by activating the kinase PKC-θ in T cells. Nat. Immunol. (1529-2908) 2011 imex curation Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 unable to determine the species of Flag-SLP76 and GST-PKCtheta/Myc-PKCtheta, and have not heard back from author. Those interactions are therefore omitted. Update 02/22/12: author correspondence confirmed sp. of the tagged recombinants. ttan@nhri.org.tw 14-Mar-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Chuang H.C., Lan J.L., Chen D.Y., Yang C.Y., Chen Y.M., Li J.P., Huang C.Y., Liu P.E., Wang X., Tan T.H. Curated by: InnateDB - a knowledge resource for innate immunity species of Flag-GLK determined through ref. 6 ttan@nhri.org.tw Accepted 2012-JAN-13 by ORCHARD 14-Mar-2012: Contacted by JYOTI. Nat. Immunol. (1529-2908) 2011 Only protein-protein interactions imex curation lcp2_human Lymphocyte cytosolic protein 2 LCP2 SH2 domain-containing leukocyte protein of 76 kDa SLP-76 tyrosine phosphoprotein protein protein human Homo sapiens Human MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTKPPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRSLGEHLPKIQKPPLPPTTERHERSSPLPGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRSTKPSPMNPLPSSHMPGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPLPLPNKPRPPSPAEEENSLNEEWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKESQVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP DIP protein Q13094 original sequence version: 141 DIP protein Q13094 original sequence version: 98 DIP protein Q13094 original sequence version: 113 C5D22F31D36200C8 kpct_human Protein kinase C theta type PRKCQ nPKC-theta PRKCT protein protein human Homo sapiens Human MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNARYFLEMSDTKDMNEFETEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWESPLDEVDKMCHLPEPELNKERPSLQIKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFCGTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFDCSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPGMERLIS B3C53AB892D5210A kpct_mouse Protein kinase C theta type Prkcq Pkcq nPKC-theta protein protein mouse Mus musculus Mouse MSPFLRIGLSNFDCGTCQACQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGRTEIWLELKPQGRMLMNARYFLEMSDTKDMSEFENEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQARSLRDSEHIFREGPVEIGLPCSTKNETRPPCVPTPGKREPQGISWDSPLDGSNKSAGPPEPEVSMRRTSLQLKLKIDDFILHKMLGKGSFGKVFLAEFKRTNQFFAIKALKKDVVLMDDDVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEVILGLQFLHSKGIVYRDLKLDNILLDRDGHIKIADFGMCKENMLGDAKTNTFCGTPDYIAPEILLGQKYNHSVDWWSFGVLVYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEREAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPYDCSNFDKEFLSEKPRLSFADRALINSMDQNMFSNFSFINPGMETLICS DIP protein Q02111 original sequence version: 120 7A16492116CD2880 lcp2_mouse Lymphocyte cytosolic protein 2 Lcp2 SH2 domain-containing leukocyte protein of 76 kDa SLP-76 tyrosine phosphoprotein protein protein mouse Mus musculus Mouse MALKNVPFRSEVLAWNSDNLADYFRKLNYRDCEKAVKKYHIDGARFLNLTENDIQKFPKLRMPLLSKLSQDINKNEERRSIFTRKPQIPRFLEETESHEEDDGGWSSFEDDYESPNDDDPDGEDDGDYESPNEEEQALVDDAADYEPPPSNNEEALQSSILPPNSFHNTNSMYIDRPPTGKVSQQPPVPPLRPKPALPPLPTGRNHSPLSPPHPNHEEPSRSGNNKTAKLPAPSIDRSTKPPLDRSLAPLDREPFILGKKPPFSDKPSAPLGREHLPKIQKPPLPPAMDRHERNERLGPVTTRKPPVPRHGRGPDRRENDEDDVHQRPLPQPSLPSMSSNTFPSRSVQPSSKNTFPLAHMPGAFSESNIGFQQSASLPPYFSQGPGNRPPLRSEGRNLPLPVPNRPQPPSPGEEETPLDEEWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTANNPYVLMVLYKDKVYNIQIRYQEESQVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGCL 50AEA025EF0DAD01 m4k3_human Mitogen-activated protein kinase kinase kinase kinase 3 MAP4K3 RAB8IPL1 MAPK/ERK kinase kinase kinase 3 Germinal center kinase-related protein kinase protein protein human Homo sapiens Human MNPGFDLSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHPNIVAYFGSYLRRDKLWICMEFCGGGSLQDIYHVTGPLSELQIAYVSRETLQGLYYLHSKGKMHRDIKGANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNQLCDLWAVGITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNSFHHFVKMALTKNPKKRPTAEKLLQHPFVTQHLTRSLAIELLDKVNNPDHSTYHDFDDDDPEPLVAVPHRIHSTSRNVREEKTRSEITFGQVKFDPPLRKETEPHHELPDSDGFLDSSEEIYYTARSNLDLQLEYGQGHQGGYFLGANKSLLKSVEEELHQRGHVAHLEDDEGDDDESKHSTLKAKIPPPLPPKPKSIFIPQEMHSTEDENQGTIKRCPMSGSPAKPSQVPPRPPPPRLPPHKPVALGNGMSSFQLNGERDGSLCQQQNEHRGTNLSRKEKKDVPKPISNGLPPTPKVHMGACFSKVFNGCPLKIHCASSWINPDTRDQYLIFGAEEGIYTLNLNELHETSMEQLFPRRCTWLYVMNNCLLSISGKASQLYSHNLPGLFDYARQMQKLPVAIPAHKLPDRILPRKFSVSAKIPETKWCQKCCVVRNPYTGHKYLCGALQTSIVLLEWVEPMQKFMLIKHIDFPIPCPLRMFEMLVVPEQEYPLVCVGVSRGRDFNQVVRFETVNPNSTSSWFTESDTPQTNVTHVTQLERDTILVCLDCCIKIVNLQGRLKSSRKLSSELTFDFQIESIVCLQDSVLAFWKHGMQGRSFRSNEVTQEISDSTRIFRLLGSDRVVVLESRPTDNPTANSNLYILAGHENSY 6EB77BBB34E5B733 m4k3_mouse Mitogen-activated protein kinase kinase kinase kinase 3 Map4k3 Germinal center kinase-related protein kinase MAPK/ERK kinase kinase kinase 3 protein protein mouse Mus musculus Mouse MNPGFDLSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHPNIVAYFGSYLRRDKLWICMEFCGGGSLQDIYHVTGPLSELQIAYVSRETLQGLYYLHSKGKMHRDIKGANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVERKGGYNQLCDLWAVGITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKLKWSNSFHHFVKMALTKNPKKRPNAEKLLQHPFVTQPLTRSLAIELLDKVNNPDHSTYHDFDDDDPEPLVAVPHRIPSTSRNVREEKTRSEINFGQVKFDPPLRKETEPHHELPDSDGFFDSSEEIYYTARSNLDLQLEYGQGHQSHCFLGGNKSLLKSVEEELHQRGHVAHLEDDEGDDDDSKHSTMKAKVPPPLPPKPKSIFIPQDTHSAEDGNQGTIKRCPSSGSPAKPSHVPPRPPPPRLPPQKPAVLGNGVNSFQLNGERDGSLYQQQSEQRGTNLSRKEKKDVPKPISNGLPPTPKVHMGACFSKVFNGCPLKIHCATSWINPDTRDQYLIFGAEEGIYTLNLNELHETSMEQLFPRRCTWLYVMNNCLLSVSGKASQLYSHNLPGLFDYARQMQKLPVAIPAHKLPDRILPRKFAVSAKIPETKWCQKCCVVRNPYTGHKYLCGALQTSIVLLEWVEPMQKFMLIKHIEFPMPCPLRMFEMLVVPEQEYPLVCVGVSRGRDFNQVVRFETVNPNSTSSWFTESDAPQTSVTHVTQLERDTILVCLDCCIKIVNLQGRLKSSRKLSSELTFDFQIESIVCLQDSVLAFWKHGMQGRSFRSNEVTQEISDNTRIFRLLGSDRVVVLESRPTDNPTANSNLYILAGHENSY A9D9086ADC9DDA4F map4k3-prkcq 8 16 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association Fig. 1B anti-CD3 map4k3-lcp2 8 16 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey association association Fig. 2A anti-CD3 map4k3-1 5 15 putative self putative self putative self putative self region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined phosphorylation phosphorylation reaction phosphorylation true Fig. S2C anti-CD3 map4k3-prkcq-1 6 12 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. S3B anti-CD3 map4k3-lcp2-1 6 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. S4C anti-CD3 map4k3-lcp2-2 3 14 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey association association Fig. S3C anti-CD3 lcp2-map4k3 10 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig. 2B lcp2-map4k3-1 10 15 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig. 2B map4k3-prkcq-2 9 15 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig. 1C map4k3-prkcq-3 1 12 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig. 1C map4k3-prkcq-5 4 15 enzyme enzyme neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 enzyme target enzyme target substrate substrate neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined thr538p phosphorus containing modified residue phosphorus containing modified residue western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain phosphorylation phosphorylation reaction phosphorylation Fig. 1E map4k3-prkcq-6 7 15 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. S3. map4k3-prkcq-7 7 13 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. S3A. lcp2-map4k3-6 6 15 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. S4B anti-CD3 lcp2-map4k3-3 2 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. S4A lcp2-map4k3-4 2 11 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 16 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. S4A lcp2-map4k3-5 2 11 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 15 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. S4D pervanadate