mpidb The Microbial Protein Interaction Database Canonical SecA associates with an accessory secretory protein complex involved in biogenesis of a streptococcal serine-rich repeat glycoprotein. Canonical SecA associates with an accessory secretory protein complex involved in biogenesis of a streptococcal serine-rich repeat glycoprotein. J. Bacteriol. (0021-9193) 2011 imex curation Zhou M., Zhang H., Zhu F., Wu H. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions strpa streptococcus parasanguinis fw213 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhou M., Zhang H., Zhu F., Wu H. Accepted 2012-DEC-06 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation Canonical SecA associates with an accessory secretory protein complex involved in biogenesis of a streptococcal serine-rich repeat glycoprotein. Canonical SecA associates with an accessory secretory protein complex involved in biogenesis of a streptococcal serine-rich repeat glycoprotein. J. Bacteriol. (0021-9193) 2011 imex curation Zhou M., Zhang H., Zhu F., Wu H. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions strpa streptococcus parasanguinis fw213 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhou M., Zhang H., Zhu F., Wu H. Accepted 2012-DEC-06 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation Canonical SecA associates with an accessory secretory protein complex involved in biogenesis of a streptococcal serine-rich repeat glycoprotein. Canonical SecA associates with an accessory secretory protein complex involved in biogenesis of a streptococcal serine-rich repeat glycoprotein. J. Bacteriol. (0021-9193) 2011 imex curation Zhou M., Zhang H., Zhu F., Wu H. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Zhou M., Zhang H., Zhu F., Wu H. Accepted 2012-DEC-06 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation q3s2y6_strag asp1 protein protein streptococcus agalac Streptococcus agalactiae MFYFIPSWYNSDQKWHNEAPIWYRVLENMTFDDTVSQVRMFQNADEEVRLLLFSYNPQLRYMLHEESMLAVSYWSFFDDIQNIQQKEIKLINFKELNWPKGTYFVYTPFLVLAKHGGEIIARIQFAENGNLLLIELLIDGVLDKIMIFDDRGFVSSIKYFKQNRLIYQDYLNQNGVWQIREYASKFPRIVVNPMSDKVFNFTEYDDWDTLIRERILVLKKLEVTPDDYIIVAVNDIHNNLVRKSFPDQKKIFSFFGERYSFDNRLDFNELLDEGELFIAESEKIERLLITSLQEKNYSSNYVENHISRIPPFDTRLRLGQSQNIEELIAYLLVDDLSQTYLSEVLDQLLAKMEVNPSLELKIVSYKNDYDMTSLKEQVKDKILSSKNPDYFFTSLSLEDENHFKEEQKTKIRGISFDIYTNENQIIDALDTARLVIDLRDDPDLYTQIAALSSGIPQINKVHTNYVEHQKNGWIISDSTELNNAIDYYFDGLMNWNKSLVYSVKKMGDYTSGKILQRWRKLLEKE C1CA7D9D9936B05A a1c3l7_strpa protein protein streptococcus parasa Streptococcus parasanguis MTKQLISEIYWNEIRKGENYLYGSQIKFQEDLVNFYNPQLASGKPIVTFKSRTNYQGDRHSPDLPILIQGNRYLLEYQIDAVPANSFFLQLDFFNRQAEQIESIVLRNSGESFIFPKDTFTYTLTLMSAGCQSVTYQKFMIYDINDEEKKNHIVENRYLRELLPKDLDLVKNLIEYI BD713B707C9C02ED q7wwk0_strpa Protein translocase subunit SecA secA protein protein streptococcus parasa Streptococcus parasanguis MANLLKTIIENDRGEIKRLEKMADKVFSYEEQMAALTDDELKAKTVEFKQRYQDGESLDDLLYEAFAVVREGAKRVLGLFPYKVQVMGGIVLHHGDVPEMRTGEGKTLTATMPVYLNALSGKGVHVVTVNEYLTERDATEMGELYSWLGLSVGINLAAKSPAEKKEAYLCDITYSTNSEIGFDYLRDNMVVRAENMVQRPLNYALVDEVDSILIDEARTPLIVSGQTASDTSQLYHMADAYVKTLTEDDYIIDVPSKTIGLSDSGIDKAESYFNLENLYDIENVALTHFIDNALRANYIMILDIDYVVSEDQEILIVDQFTGRTMEGRRYSDGLHQAIEAKEGVPVQEETKTSASITYQNLFRMYKKLSGMTGTGKTEEEEFREIYNIRVIPIPTNRPIARIDHPDLLYPSLKSKFKAVVEDVKSRHEKGQPVLVGTVAVETSDYLSQLLVQAGVPHEVLNAKNHYKEAQIIMNAGQRGAVTIATNMAGRGTDIKLGEGVRELGGLCVIGTERHESRRIDNQLRGRSGRQGDPGESQFYLSLEDELMRRFGSERIKAVLDRFKLSEEESVIRSNMFTRQVEGAQKRVEGNNYDTRKQVLQYDDVMREQREIIYAERYDVITANRDLAPEIKAMIKRTIKRIVEGASHSSKEERIEAILNFAKYNLVPEDTISESDIEGKSDKEVIDYLYARAEEIYASQVAKLRDEESVQEFQKVLILRVVDSKWTDHIDALDQLRNAVGLRGYAQNNPVVEYQSESFRMFNDMIGSIEFDVTRLMMKAQIHEQERPRTEHSISTTATRNIAAQQDIPSGIDLSQVKRNDLCPCGSGKKFKNCHGRKF CC6D826EDEEA0CDB q7wuf6_strpa Protein translocase subunit SecA secA2 secA protein protein streptococcus parasa Streptococcus parasanguis MEKIKQKRSFINTMKLRRLRKKLVKINALKETMSLLSDEELKQKTVEFRNRLHEGETLEDILIEAFAAIREADRRILGMFPFDVQVLGALALHEGTIVEMKTGEGKTLTATLPLYLNALEGKGTILVTTNDYLARRDAIDMGEVYRFMGLTVGVGVFDDDEEVDSNRKKKIYSSDILYTTSTALGFDYLIDNLAGNVEDKFLRSFNYVIVDEADAVLLDSAQTPLIIAGSPRVQSNLYDTADQFIRTLKKDQEFKFLKDEKFIFLTDEGIRYAEKYFNIPNLYSEEYFELNRHINLALRAHYLFKKDMDYVVTDDAVELLDNRTGRILEGTRLQSGIHQAIETKEKVKKSKDSRAIASVTYQSLFNMFPKLSGMTGTGKIAENELISTYGVSVVVLPTNTPIQRLDYSDKIYTTLPEKLLATLEFVKELHEKQQPILLISGTVDIAEIYSRMLLQEGIPHNVLTAKNIAKEALIIAEAGQKGAVTVATSLAGRGTDIKLGKGVAELGGLAVIGTERMPNSRIDWQLRGRAGRQGDPGLSQFFVSLEDDLIMNHANRRLKKYFEKQNSIDRKNYGKPLFSKRFSRIVTHAQQKSEDKSESARQNTIKFDESLKSQRKKIYHLRDQLIFGEVKLRDRLDKLISEYIEMYMENNRKFGLNQNDFKRFILENFTYQLRSLPKSLDLSNSRQVKDYLFYLYQLEMERKSKQLKTDSKVEEFIRLSILRAIDECWIQQVDHLQQLKTFVSMRQIAQRDSFNEYLRESLESYEEMSREVKHAIVKNVMLSTIEGKVDDGLSIYFV E4C1613B85E0DD79 q3s2y4_strag asp3 protein protein streptococcus agalac Streptococcus agalactiae MILGECLVVKKRIQKVLWTDSSNVYLYGSTIKYLEHNRVFFENLRFSTGKTIKKWLSKTNFQANRTLPELTLLKPNHTYELVSKLTTVPEGCVIIQINFYNRQKEKIGFSIIRDHSSDFIVPDDTYFYDISLIGAGCISVEFCYLELFEVIETQEEKDGIELNSYVESSLPSELELIRTLIAFSKDKK 01D482C5C10FC8BA a1c3l5_strpa gap1 protein protein streptococcus parasa Streptococcus parasanguis MFYFVPSWYNGQRQWYYDTPWWFRVKNRMTFDDSVNQVKMFLQGQEEIGLMILNYQPQLRYFLHKQNIFGIYYWSFFDDIQNITRSYTKIIHLKDLNWPEGCEFLYSPFAVVVRLKGEIFAIVNYAEDGNLHSVSFQKNGKVTKDYIFDDRGFLSSILYYDIDERPLYQDYLNINGVWQVREFLKKENDPTPILMINDFSDQTFSKKYYNGWEELIKERLAIFQNNHVENEDVFVLASDTQHNQLVSSIFKEHRKIYSFFGNRFNLENLGQDRISINDATFLVVDTEKNEELLRKTCENLVFKSIPIVRLSPFDSRLRLGHSQTVKEQIIYFHIDNIELDELYSVIAIILELMTLHLDIELRIVTFRQDFQLDLLKTWIIDFIKTNHFEDLLFKQISEGENEIEDEGEIELSRIAMECFTNENQIIKCLDTARLVIDLGIEPDLYTQIASISAGIPQINRVSSDYVIHQKNGLVISDISKLSSAIEFYFDGLFNWNEALIYAVRKMSDYTSGKILKQWKGMLKKK F3EA2C330D5814F0 q3s2y3_strag Protein translocase subunit SecA secA2 secA protein protein streptococcus agalac Streptococcus agalactiae MKKVVVKPKISILNKLRLQRIQKIVNEINNKKVYYAQLSDKELSHQTLILKNRLSSGESLDDILVDAFAVIREANKRILGLFPYDAQVMGAIALHQGTIAEMKTGEGKTLTATMPLYLNALTSKGAILVTTNDYLAKRDALEMGKVYQFLGMTVGINVFDKKEEADATIKREVYESDITYTTAGALGFDYLVHNLASNKLEQFLRPFHFVIVDEADSVLLDIAQTPLIIAGDPRVQSNLYGITNNFVLTLKENDEYIHKAKDKIVYLTEKGVSYAKQYFNISELYNDEYWELNRHINLALRAHCLYKRDYDYVVKNNEVKLLDNATGRVMEGTKLQSGIHQAIEAKEDVALTNESRAIASITYQSLFNMFPRLSGMTGTGKSSEDELIKTYHLPVIVIPTNFPIKRVDLADKIYVSLPEKLQATIDDVKQRHSKGQPVLLISGTVEIANIYSKLLLREGIAHNTLTADNVVKEAQIIKEAGQKGSVTCATVLAGRGTDIKLGEGVRELGGLAVIGTERMPNLRMDWQLRGRSGRQGDPGISQFYVSLEDELIVSHSPEWVIKYLKKYSRKETSNYYMVPRKKRFFYQIVKNAQLRSEDKGVSSREQTIKFGESLRIQRENIYQLRNELIADSSIVVDGVIKIIQDNFNDIANDKDLTEHSLRRYILENLTYKFKYFPDEFDVHNSDDVFKLLIDIFDREFTAKKTKLQSDNEFDNFVRISILKAIDKSWIEEVDSLQQLKGVVTNRGIGQRDIIQEYYKESLNSYYKMGKEIRYSIVKNIMLSTISKASDGSYSIYYV E595906D84C7E5C4 a1c3l7-seca-2 3 5 unspecified role unspecified role bait bait a1c3l7-- A1C3L7-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 6 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association figure 7C a1c3l7-seca-3 3 7 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 5 unspecified role unspecified role bait bait a1c3l7-- A1C3L7-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association figure 7A seca-gap3 3 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 5 unspecified role unspecified role prey prey a1c3l7-- A1C3L7-- myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association figure 7B seca2-seca 3 6 unspecified role unspecified role bait bait q7wwk0-- Q7WWK0-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey q7wuf6-- Q7WUF6-- myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 7A asp1-seca2 3 4 unspecified role unspecified role bait bait q3s2y6-- Q3S2Y6-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey region Q3S2Y3-- myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 5C asp1-asp3 3 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait q3s2y6-- Q3S2Y6-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 5B asp3-asp1 3 4 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 5A seca2-asp3 3 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait q3s2y3-- Q3S2Y3-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 5B seca2-asp1 3 4 unspecified role unspecified role prey prey q3s2y6-- Q3S2Y6-- myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait q3s2y3-- Q3S2Y3-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 5A a1c3l7-seca-1 3 7 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 5 unspecified role unspecified role bait bait a1c3l7-- A1C3L7-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association figure 2B gap1-seca2 3 7 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 9 unspecified role unspecified role bait bait a1c3l5-- A1C3L5-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association figure 2B seca2-gap1 3 7 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 9 unspecified role unspecified role prey prey a1c3l5-- A1C3L5-- myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 2A a1c3l7-seca2-1 2 6 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 6B seca2-seca-1 1 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association figure 6A gap1-a1c3l7-1 2 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait region A1C3L5-- gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association figure 3