IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The beta-catenin binding protein ICAT modulates androgen receptor activity. The beta-catenin binding protein ICAT modulates androgen receptor activity. Mol. Endocrinol. (0888-8809) 2011 imex curation Zhuo M., Zhu C., Sun J., Weis W.I., Sun Z. Cancer - Interactions investigated in the context of cancer email sent 11/05/12 Dear Checker - whoever you are. We do not have a subsription to this journal. Please email/shout at me and I will forward you a pdf copy of the paper. I have left in the "in vitro ICAT etc... " interactions in case you can find a more reliable source for them which I cannot....other wise to be deleted?? (Fig - 5B GST-Beta catenin and GST-ICAT have been identified as Human in origin from References 19, and 28 respectively. The same references (19,28) also refer to Human AR and Human ICAT proteins. No origin, nor any references are provided for "TCF-1", and this molecule has been deduced to be TCF-7 ( ID=P36402 for Human). zsun@stanford.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-lapc4 Homo sapiens LAPC4 cells derived from a human prostate cancer xenograft lapc4 Human prostate cancer xenograft cell line LAPC4 LAPC4 cells were derived from a human prostate cancer xenograft implanted in SCID mice and express wild-type androgen receptor ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Zhuo M., Zhu C., Sun J., Weis W.I., Sun Z. Cancer - Interactions investigated in the context of cancer email sent 11/05/12 GST-Beta catenin and GST-ICAT have been identified as Human in origin from References 19, and 28 respectively. The same references (19,28) also refer to Human AR and Human ICAT proteins. No origin, nor any references are provided for "TCF-1", and this molecule has been deduced to be TCF-7 ( ID=P36402 for Human). zsun@stanford.edu Accepted 2012-JUN-06 by ORCHARD 20-Jun-2012: Contacted by JYOTI. Mol. Endocrinol. (0888-8809) 2011 Only protein-protein interactions imex curation The beta-catenin binding protein ICAT modulates androgen receptor activity. The beta-catenin binding protein ICAT modulates androgen receptor activity. Mol. Endocrinol. (0888-8809) 2011 imex curation Zhuo M., Zhu C., Sun J., Weis W.I., Sun Z. Cancer - Interactions investigated in the context of cancer email sent 11/05/12 Dear Checker - whoever you are. We do not have a subsription to this journal. Please email/shout at me and I will forward you a pdf copy of the paper. I have left in the "in vitro ICAT etc... " interactions in case you can find a more reliable source for them which I cannot....other wise to be deleted?? (Fig - 5B GST-Beta catenin and GST-ICAT have been identified as Human in origin from References 19, and 28 respectively. The same references (19,28) also refer to Human AR and Human ICAT proteins. No origin, nor any references are provided for "TCF-1", and this molecule has been deduced to be TCF-7 ( ID=P36402 for Human). zsun@stanford.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhuo M., Zhu C., Sun J., Weis W.I., Sun Z. Cancer - Interactions investigated in the context of cancer email sent 11/05/12 GST-Beta catenin and GST-ICAT have been identified as Human in origin from References 19, and 28 respectively. The same references (19,28) also refer to Human AR and Human ICAT proteins. No origin, nor any references are provided for "TCF-1", and this molecule has been deduced to be TCF-7 ( ID=P36402 for Human). zsun@stanford.edu Accepted 2012-JUN-06 by ORCHARD Mol. Endocrinol. (0888-8809) 2011 Only protein-protein interactions imex curation The beta-catenin binding protein ICAT modulates androgen receptor activity. The beta-catenin binding protein ICAT modulates androgen receptor activity. Mol. Endocrinol. (0888-8809) 2011 imex curation Zhuo M., Zhu C., Sun J., Weis W.I., Sun Z. Cancer - Interactions investigated in the context of cancer email sent 11/05/12 Dear Checker - whoever you are. We do not have a subsription to this journal. Please email/shout at me and I will forward you a pdf copy of the paper. I have left in the "in vitro ICAT etc... " interactions in case you can find a more reliable source for them which I cannot....other wise to be deleted?? (Fig - 5B GST-Beta catenin and GST-ICAT have been identified as Human in origin from References 19, and 28 respectively. The same references (19,28) also refer to Human AR and Human ICAT proteins. No origin, nor any references are provided for "TCF-1", and this molecule has been deduced to be TCF-7 ( ID=P36402 for Human). zsun@stanford.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-lapc4 Homo sapiens LAPC4 cells derived from a human prostate cancer xenograft lapc4 Human prostate cancer xenograft cell line LAPC4 LAPC4 cells were derived from a human prostate cancer xenograft implanted in SCID mice and express wild-type androgen receptor anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhuo M., Zhu C., Sun J., Weis W.I., Sun Z. Cancer - Interactions investigated in the context of cancer email sent 11/05/12 GST-Beta catenin and GST-ICAT have been identified as Human in origin from References 19, and 28 respectively. The same references (19,28) also refer to Human AR and Human ICAT proteins. No origin, nor any references are provided for "TCF-1", and this molecule has been deduced to be TCF-7 ( ID=P36402 for Human). zsun@stanford.edu Accepted 2012-JUN-06 by ORCHARD 20-Jun-2012: Contacted by JYOTI. Mol. Endocrinol. (0888-8809) 2011 Only protein-protein interactions imex curation The beta-catenin binding protein ICAT modulates androgen receptor activity. The beta-catenin binding protein ICAT modulates androgen receptor activity. Mol. Endocrinol. (0888-8809) 2011 imex curation Zhuo M., Zhu C., Sun J., Weis W.I., Sun Z. Cancer - Interactions investigated in the context of cancer email sent 11/05/12 Dear Checker - whoever you are. We do not have a subsription to this journal. Please email/shout at me and I will forward you a pdf copy of the paper. I have left in the "in vitro ICAT etc... " interactions in case you can find a more reliable source for them which I cannot....other wise to be deleted?? (Fig - 5B GST-Beta catenin and GST-ICAT have been identified as Human in origin from References 19, and 28 respectively. The same references (19,28) also refer to Human AR and Human ICAT proteins. No origin, nor any references are provided for "TCF-1", and this molecule has been deduced to be TCF-7 ( ID=P36402 for Human). zsun@stanford.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhuo M., Zhu C., Sun J., Weis W.I., Sun Z. Cancer - Interactions investigated in the context of cancer email sent 11/05/12 GST-Beta catenin and GST-ICAT have been identified as Human in origin from References 19, and 28 respectively. The same references (19,28) also refer to Human AR and Human ICAT proteins. No origin, nor any references are provided for "TCF-1", and this molecule has been deduced to be TCF-7 ( ID=P36402 for Human). zsun@stanford.edu Accepted 2012-JUN-06 by ORCHARD 20-Jun-2012: Contacted by JYOTI. Mol. Endocrinol. (0888-8809) 2011 Only protein-protein interactions imex curation The beta-catenin binding protein ICAT modulates androgen receptor activity. The beta-catenin binding protein ICAT modulates androgen receptor activity. Mol. Endocrinol. (0888-8809) 2011 imex curation Zhuo M., Zhu C., Sun J., Weis W.I., Sun Z. Cancer - Interactions investigated in the context of cancer email sent 11/05/12 Dear Checker - whoever you are. We do not have a subsription to this journal. Please email/shout at me and I will forward you a pdf copy of the paper. I have left in the "in vitro ICAT etc... " interactions in case you can find a more reliable source for them which I cannot....other wise to be deleted?? (Fig - 5B GST-Beta catenin and GST-ICAT have been identified as Human in origin from References 19, and 28 respectively. The same references (19,28) also refer to Human AR and Human ICAT proteins. No origin, nor any references are provided for "TCF-1", and this molecule has been deduced to be TCF-7 ( ID=P36402 for Human). zsun@stanford.edu 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-lapc4 Homo sapiens LAPC4 cells derived from a human prostate cancer xenograft lapc4 Human prostate cancer xenograft cell line LAPC4 LAPC4 cells were derived from a human prostate cancer xenograft implanted in SCID mice and express wild-type androgen receptor anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhuo M., Zhu C., Sun J., Weis W.I., Sun Z. Cancer - Interactions investigated in the context of cancer email sent 11/05/12 GST-Beta catenin and GST-ICAT have been identified as Human in origin from References 19, and 28 respectively. The same references (19,28) also refer to Human AR and Human ICAT proteins. No origin, nor any references are provided for "TCF-1", and this molecule has been deduced to be TCF-7 ( ID=P36402 for Human). zsun@stanford.edu Accepted 2012-JUN-06 by ORCHARD 20-Jun-2012: Contacted by JYOTI. Mol. Endocrinol. (0888-8809) 2011 Only protein-protein interactions imex curation cnbp1_human Beta-catenin-interacting protein 1 Inhibitor of beta-catenin and Tcf-4 CTNNBIP1 ICAT protein protein human Homo sapiens Human MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ 3DA6CF90B50CE942 klk3_human_gene Human kallikrein-related peptidase 3 (KLK3) (PSA) gene gene human Homo sapiens Human ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL DIP protein P35222 original sequence version: 187 DIP protein P35222 original sequence version: 188 DIP protein P35222 original sequence version: 180 DIP protein P35222-1 original sequence version: 181 DIP protein P35222 original sequence version: 181 DIP protein P35222 original sequence version: 107 DIP protein P35222-1 original sequence version: 107 DIP protein P35222 original sequence version: 103 DIP protein P35222-1 original sequence version: 103 DIP protein P35222 original sequence version: 175 DIP protein P35222 original sequence version: 136 DIP protein P35222 original sequence version: 135 DIP protein P35222 original sequence version: 131 DIP protein P35222-1 original sequence version: 133 DIP protein P35222 original sequence version: 133 DIP protein P35222 original sequence version: 148 DIP protein P35222-1 original sequence version: 139 DIP protein P35222 original sequence version: 139 DIP protein P35222 original sequence version: 146 DIP protein P35222 original sequence version: 196 DIP protein P35222 original sequence version: 192 DIP protein P35222 original sequence version: 185 DIP protein P35222 original sequence version: 151 DIP protein P35222-1 original sequence version: 151 DIP protein P35222-1 original sequence version: 171 DIP protein P35222-1 original sequence version: 148 DIP protein P35222 original sequence version: 177 DIP protein P35222 original sequence version: 178 DIP protein P35222-1 original sequence version: 178 CB78F165A3EEF86E andr_human Androgen receptor Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4 AR DHTR NR3C4 protein protein human Homo sapiens Human MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ DIP protein P10275 original sequence version: 220 DIP protein P10275-1 original sequence version: 213 DIP protein P10275 original sequence version: 216 DIP protein P10275 original sequence version: 143 DIP protein P10275 original sequence version: 174 DIP protein P10275 original sequence version: 169 DIP protein P10275 original sequence version: 188 DIP protein P10275-1 original sequence version: 188 DIP protein P10275 original sequence version: 196 DIP protein P10275 original sequence version: 217 DIP protein P10275-1 original sequence version: 217 DIP protein P10275-1 original sequence version: 207 A73432C55D39AE06 ctnnb1-ar-1 2 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig 5B ctnnb1-ar-1 2 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro 6 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined in vitro In vitro association association Fig 5B ctnnb1-ar-1 4 6 unspecified role unspecified role ancillary ancillary n_terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role prey prey human-lapc4 Homo sapiens LAPC4 cells derived from a human prostate cancer xenograft lapc4 Human prostate cancer xenograft cell line LAPC4 LAPC4 cells were derived from a human prostate cancer xenograft implanted in SCID mice and express wild-type androgen receptor 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5C Truncated ICAT ( N-terminal region) showed greater GST-beta catenin binding to AR, than full length ICAT. ctnnbip1-ar-2 5 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey association association Fig 5E ctnnbip1-ar-3 3 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait association association Fig 6 ar-ctnnb1-4 3 9 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association Fig 6 ar-klk3-1 1 7 unspecified role unspecified role prey prey are_promoter_region (-164 to -406 from tss) binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined are_promoter_region (-3978 to -4170 from tss) binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined are_promoter_region (-39 to -250 from tss) binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait association association Fig 6E DHT icat-klk3 1 6 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey are_promoter_region (-164 to -406 from tss) binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined are_promoter_region (-3978 to -4170 from tss) binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined are_promoter_region (-39 to -250 from tss) binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 6E DHT ctnnbip1-ar-4 4 9 unspecified role unspecified role prey prey human-lapc4 Homo sapiens LAPC4 cells derived from a human prostate cancer xenograft lapc4 Human prostate cancer xenograft cell line LAPC4 LAPC4 cells were derived from a human prostate cancer xenograft implanted in SCID mice and express wild-type androgen receptor 8 unspecified role unspecified role ancillary ancillary 6 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 5D Direct binding between ICAT and AR proteins was not detected when beta-catenin was absent. I have not entered the GST tag for Beta catenein ancillary -as it has the same result without.