IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction of nectin-like molecule 2 with integrin alpha6beta4 and inhibition of disassembly of integrin alpha6beta4 from hemidesmosomes. Interaction of nectin-like molecule 2 with integrin alpha6beta4 and inhibition of disassembly of integrin alpha6beta4 from hemidesmosomes. J. Biol. Chem. (0021-9258) 2011 imex curation Mizutani K., Kawano S., Minami A., Waseda M., Ikeda W., Takai Y. Cancer - Interactions investigated in the context of cancer For early Expts I have NOT entered the other integrin transfected as the expt protocol does not detect it. email sent for integrin sp. 9/2/12-No Reply. FLAG-NEcl-2 = Ref 3 = MOUSE Q8R5M8-4 -isoform 4! reblasting = isoform 2! The origins of integrins alpha 1+6 and beta1+4 has been found from previous publications by Sonnenberg (Beta 4 from Hogervorst et al. EMBO Journal 1990, Alpha6 from Delwel et al 1993 JBC). and Norman (both alpha5 and beta1 from Roberts et al 2001( supplement)). The authors of this paper have not confirmed this info. ytakai@med.kobe-u.ac.jp Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Mizutani K., Kawano S., Minami A., Waseda M., Ikeda W., Takai Y. Cancer - Interactions investigated in the context of cancer For early Expts I have NOT entered the other integrin transfected as the expt protocol does not detect it. The origins of integrins alpha 1+6 and beta1+4 has been found from previous publications by Sonnenberg (Beta 4 from Hogervorst et al. EMBO Journal 1990, Alpha6 from Delwel et al 1993 JBC). and Norman (both alpha5 and beta1 from Roberts et al 2001( supplement)). The authors of this paper have not confirmed this info. ytakai@med.kobe-u.ac.jp Accepted 2012-FEB-29 by JYOTI J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Interaction of nectin-like molecule 2 with integrin alpha6beta4 and inhibition of disassembly of integrin alpha6beta4 from hemidesmosomes. Interaction of nectin-like molecule 2 with integrin alpha6beta4 and inhibition of disassembly of integrin alpha6beta4 from hemidesmosomes. J. Biol. Chem. (0021-9258) 2011 imex curation Mizutani K., Kawano S., Minami A., Waseda M., Ikeda W., Takai Y. Cancer - Interactions investigated in the context of cancer For early Expts I have NOT entered the other integrin transfected as the expt protocol does not detect it. email sent for integrin sp. 9/2/12-No Reply. FLAG-NEcl-2 = Ref 3 = MOUSE Q8R5M8-4 -isoform 4! reblasting = isoform 2! The origins of integrins alpha 1+6 and beta1+4 has been found from previous publications by Sonnenberg (Beta 4 from Hogervorst et al. EMBO Journal 1990, Alpha6 from Delwel et al 1993 JBC). and Norman (both alpha5 and beta1 from Roberts et al 2001( supplement)). The authors of this paper have not confirmed this info. ytakai@med.kobe-u.ac.jp Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Mizutani K., Kawano S., Minami A., Waseda M., Ikeda W., Takai Y. Cancer - Interactions investigated in the context of cancer For early Expts I have NOT entered the other integrin transfected as the expt protocol does not detect it. The origins of integrins alpha 1+6 and beta1+4 has been found from previous publications by Sonnenberg (Beta 4 from Hogervorst et al. EMBO Journal 1990, Alpha6 from Delwel et al 1993 JBC). and Norman (both alpha5 and beta1 from Roberts et al 2001( supplement)). The authors of this paper have not confirmed this info. ytakai@med.kobe-u.ac.jp Accepted 2012-FEB-29 by JYOTI J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation Interaction of nectin-like molecule 2 with integrin alpha6beta4 and inhibition of disassembly of integrin alpha6beta4 from hemidesmosomes. Interaction of nectin-like molecule 2 with integrin alpha6beta4 and inhibition of disassembly of integrin alpha6beta4 from hemidesmosomes. J. Biol. Chem. (0021-9258) 2011 imex curation Mizutani K., Kawano S., Minami A., Waseda M., Ikeda W., Takai Y. Cancer - Interactions investigated in the context of cancer For early Expts I have NOT entered the other integrin transfected as the expt protocol does not detect it. email sent for integrin sp. 9/2/12-No Reply. FLAG-NEcl-2 = Ref 3 = MOUSE Q8R5M8-4 -isoform 4! reblasting = isoform 2! The origins of integrins alpha 1+6 and beta1+4 has been found from previous publications by Sonnenberg (Beta 4 from Hogervorst et al. EMBO Journal 1990, Alpha6 from Delwel et al 1993 JBC). and Norman (both alpha5 and beta1 from Roberts et al 2001( supplement)). The authors of this paper have not confirmed this info. ytakai@med.kobe-u.ac.jp Only protein-protein interactions human-caco2 Human Caucasian colon adenocarcinoma caco2 Human Caucasian colon adenocarcinoma confocal microscopy confocal microscopy immunostaining immunostaining Mizutani K., Kawano S., Minami A., Waseda M., Ikeda W., Takai Y. Cancer - Interactions investigated in the context of cancer For early Expts I have NOT entered the other integrin transfected as the expt protocol does not detect it. The origins of integrins alpha 1+6 and beta1+4 has been found from previous publications by Sonnenberg (Beta 4 from Hogervorst et al. EMBO Journal 1990, Alpha6 from Delwel et al 1993 JBC). and Norman (both alpha5 and beta1 from Roberts et al 2001( supplement)). The authors of this paper have not confirmed this info. ytakai@med.kobe-u.ac.jp Accepted 2012-FEB-29 by JYOTI J. Biol. Chem. (0021-9258) 2011 Only protein-protein interactions imex curation itb4_human Integrin beta-4 GP150 ITGB4 protein protein human Homo sapiens Human MAGPRPSPWARLLLAALISVSLSGTLANRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRRCNTQAELLAAGCQRESIVVMESSFQITEETQIDTTLRRSQMSPQGLRVRLRPGEERHFELEVFEPLESPVDLYILMDFSNSMSDDLDNLKKMGQNLARVLSQLTSDYTIGFGKFVDKVSVPQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVDEFRNKLQGERISGNLDAPEGGFDAILQTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMSRNDERCHLDTTGTYTQYRTQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLEEAFNRIRSNLDIRALDSPRGLRTEVTSKMFQKTRTGSFHIRRGEVGIYQVQLRALEHVDGTHVCQLPEDQKGNIHLKPSFSDGLKMDAGIICDVCTCELQKEVRSARCSFNGDFVCGQCVCSEGWSGQTCNCSTGSLSDIQPCLREGEDKPCSGRGECQCGHCVCYGEGRYEGQFCEYDNFQCPRTSGFLCNDRGRCSMGQCVCEPGWTGPSCDCPLSNATCIDSNGGICNGRGHCECGRCHCHQQSLYTDTICEINYSAIHPGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVDELKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHKKKDCPPGSFWWLIPLLLLLLPLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPMLRSGNLKGRDVVRWKVTNNMQRPGFATHAASINPTELVPYGLSLRLARLCTENLLKPDTRECAQLRQEVEENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKPALLKLTEKQVEQRAFHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQLLVEAIDVPAGTATLGRRLVNITIIKEQARDVVSFEQPEFSVSRGDQVARIPVIRRVLDGGKSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELQEVDSLLRGRQVRRFHVQLSNPKFGAHLGQPHSTTIIIRDPDELDRSFTSQMLSSQPPPHGDLGAPQNPNAKAAGSRKIHFNWLPPSGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAYGAQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLVNDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQPKRPMSIPIIPDIPIVDAQSGEDYDSFLMYSDDVLRSPSGSQRPSVSDDTGCGWKFEPLLGEELDLRRVTWRLPPELIPRLSASSGRSSDAEAPHGPPDDGGAGGKGGSLPRSATPGPPGEHLVNGRMDFAFPGSTNSLHRMTTTSAAAYGTHLSPHVPHRVLSTSSTLTRDYNSLTRSEHSHSTTLPRDYSTLTSVSSHDSRLTAGVPDTPTRLVFSALGPTSLRVSWQEPRCERPLQGYSVEYQLLNGGELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIESQVHPQSPLCPLPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCEMAQGGGPATAFRVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGGPFPQLGSRAGLFQHPLQSEYSSITTTHTSATEPFLVDGLTLGAQHLEAGGSLTRHVTQEFVSRTLTTSGTLSTHMDQQFFQT DIP protein P16144 original sequence version: 196 09710FFBBD719469 cadm1_human Cell adhesion molecule 1 CADM1 IGSF4 IGSF4A NECL2 SYNCAM TSLC1 Immunoglobulin superfamily member 4 Nectin-like protein 2 Spermatogenic immunoglobulin superfamily Synaptic cell adhesion molecule Tumor suppressor in lung cancer 1 protein protein human Homo sapiens Human MASVVLPSGSQCAAAAAAAAPPGLRLRLLLLLFSAAALIPTGDGQNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTTTTTTTTTTTILTIITDSRAGEEGSIRAVDHAVIGGVVAVVVFAMLCLLIILGRYFARHKGTYFTHEAKGADDAADADTAIINAEGGQNNSEEKKEYFI CDEDE1E0C08BDD3A CDEDE1E0C08BDD3A q8blq9-2 Cell adhesion molecule 2 Cadm2 Igsf4d Necl3 Immunoglobulin superfamily member 4D Nectin-like protein 3 Synaptic cell adhesion molecule 2 protein protein mouse Mus musculus Mouse MIWKRSAVLRFYSVCGLLLQAAASKSKVKGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQALTLTCESKGKPLPEPVLWTKDGAELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDPNSLAGQNGPDHALIGGIVAVVVFVTLCSIFLLGRYLARHKGTYLTNEAKGAEDAPDADTAIINAEGSQVNAEEKKEYFI 091E493B82CAFE5B cadm3_mouse Cell adhesion molecule 3 Cadm3 Igsf4b Necl1 Syncam3 Tsll1 Immunoglobulin superfamily member 4B Nectin-like protein 1 TSLC1-like protein 1 Synaptic cell adhesion molecule 3 protein protein mouse Mus musculus Mouse MGAPSALPLLLLLACSWAPGGANLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEKRALRDNRIQLVSSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKETATLNCQSSGSKPAAQLTWRKGDQELHGDQTRIQEDPNGKTFTVSSSVSFQVTREDDGANIVCSVNHESLKGADRSTSQRIEVLYTPTAMIRPEPAHPREGQKLLLHCEGRGNPVPQQYVWVKEGSEPPLKMTQESALIFPFLNKSDSGTYGCTATSNMGSYTAYFTLNVNDPSPVPSSSSTYHAIIGGIVAFIVFLLLILLIFLGHYLIRHKGTYLTHEAKGSDDAPDADTAIINAEGGQSGGDDKKEYFI C1ADF8B57D141F3A q8r5m8-2 Cell adhesion molecule 1 Cadm1 Igsf4 Necl2 Ra175 Syncam SynCam1 Tslc1 Immunoglobulin superfamily member 4 Nectin-like protein 2 Spermatogenic immunoglobulin superfamily Synaptic cell adhesion molecule Tumor suppressor in lung cancer 1 protein protein mouse Mus musculus Mouse MASAVLPSGSQCAAAAAVAAAAAPPGLRLRLLLLLLSAAALIPTGDGQNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELKVSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASKPATTIRWFKGNKELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDAFELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPPPTTTTTTTTTTTTTILTIITDSRAGEEGTIGAVDHAVIGGVVAVVVFAMLCLLIILGRYFARHKGTYFTHEAKGADDAADADTAIINAEGGQNNSEEKKEYFI C5D5A070DAF70E55 cadm4_mouse Cell adhesion molecule 4 Cadm4 Igsf4c Necl4 Tsll2 Immunoglobulin superfamily member 4C Nectin-like protein 4 TSLC1-like protein 2 protein protein mouse Mus musculus Mouse MGRARRFQWPLLLLWAAAAGPGTGQEVQTENVTVAEGGVAEITCRLHQYDGSIVVIQNPARQTLFFNGTRALKDERFQLEEFSPRRVRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTVLVAPENPVVEVREQAVEGGEVELSCLVPRSRPAAVLRWYRDRKELKGVSSGQENGKVWSVASTVRFRVDRKDDGGIVICEAQNQALPSGHSKQTQYVLDVQYSPTARIHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESLPERAEAVGETLTLPGLVSADNGTYTCEAANKHGHARALYVLVVYDPGAVVEAQTSVPYAIVGGILALLVFLIICVLVGMVWCSVRQKGSYLTHEASGLDEQGEAREAFLNGGDGHKRKEEFFI 8E3A9DF1C3B9D23E q91wp1_mouse Pvr cd155 D7Ertd458e protein protein mouse Mus musculus Mouse MAQLARATRSPLSWLLLLFCYALRKAGGDIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPERVKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTLILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTVEHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTTTGDFPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHLGYIFLIVFVLAVVIIIAALYTIRRCRHGRALQSNPSERENVQYSSVNGDCRLNMEPNSTR 733A2305740A5187 ita6_human Integrin alpha-6 ITGA6 VLA-6 CD49 antigen-like family member F protein protein human Homo sapiens Human MAAAGQLCLLYLSAGLLSRLGAAFNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLRGHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVGGETEHDESLVPVPANSYLGLLFLTSVSYTDPDQFVYKTRPPREQPDTFPDVMMNSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDMKSAHLLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGRWNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSSRVQFRNQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSLPEVLPILNSDEPKTAHIDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKGVPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFPEKQLSCVANQNGSQADCELGNPFKRNSNVTFYLVLSTTEVTFDTPDLDINLKLETTSNQDNLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLGKPLTNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKVTCEPQKEINSLNLTESHNSRKKREITEKQIDDNRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNSTFLEEYSKLNYLDILMRAFIDVTAAAENIRLPNAGTQVRVTVFPSKTVAQYSGVPWWIILVAILAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQWITKWNENESYS B53712888B7FE3B6 cadm1-itgb4 2 8 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range delta_cytoplasmic_tail sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey physical association physical association 1Aa, Fig 2b, Fig 3a. The amount of integrin alpha6-beta4 that was co-immunoprecipitated with FLAG-Necl-2-deltaCP was about four times as much as that co-immunoprecipitated with the full-length FLAG-Necl-2. This indicates that Necl-2 interacts with integrin alpha6-beta4 through its extracellular region and that the cytoplasmic region may have an inhibitory effect for the interaction of the extracellular region of Necl-2 with integrin alpha6-beta4. cadm1-itgb4-1 1 8 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait physical association physical association 1Ab cadm1-itgb4-2 2 8 unspecified role unspecified role bait bait n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range delta_cytoplasmic_tail sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role prey prey physical association physical association Fig 3a. The amount of integrin alpha6-beta4 that was co-immunoprecipitated with FLAG-Necl-2-deltaCP was about four times as much as that co-immunoprecipitated with the full-length FLAG-Necl-2. This indicates that Necl-2 interacts with integrin alpha6-beta4 through its extracellular region and that the cytoplasmic region may have an inhibitory effect for the interaction of the extracellular region of Necl-2 with integrin alpha6-beta4. cadm2-itgb4 2 6 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey physical association physical association 3A cadm2-itgb4-1 2 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A cadm3-itgb4 2 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey physical association physical association 3A cadm4-itgb4 2 4 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3A itga6-itgb4-1 3 4 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component colocalization colocalization 4a cadm1-itgb4-3 3 5 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization 5a Co-localization of Necl-2 with integrin beta-4 at the basal side of the lateral plasma membrane.