IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The LSD1-type zinc finger motifs of Pisum sativa LSD1 are a novel nuclear localization signal and interact with importin alpha. The LSD1-type zinc finger motifs of Pisum sativa LSD1 are a novel nuclear localization signal and interact with importin alpha. PLoS ONE 2011 imex curation He S., Huang K., Zhang X., Yu X., Huang P., An C. chcaian@pku.edu.cn 15-Nov-2012: Contacted by pporras. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot He S., Huang K., Zhang X., Yu X., Huang P., An C. chcaian@pku.edu.cn Accepted 2012-NOV-01 by ORCHARD 15-Nov-2012: Contacted by pporras. PLoS ONE 2011 Only protein-protein interactions imex curation The LSD1-type zinc finger motifs of Pisum sativa LSD1 are a novel nuclear localization signal and interact with importin alpha. The LSD1-type zinc finger motifs of Pisum sativa LSD1 are a novel nuclear localization signal and interact with importin alpha. PLoS ONE 2011 imex curation He S., Huang K., Zhang X., Yu X., Huang P., An C. chcaian@pku.edu.cn 15-Nov-2012: Contacted by pporras. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined He S., Huang K., Zhang X., Yu X., Huang P., An C. chcaian@pku.edu.cn Accepted 2012-NOV-01 by ORCHARD 15-Nov-2012: Contacted by pporras. PLoS ONE 2011 Only protein-protein interactions imex curation The LSD1-type zinc finger motifs of Pisum sativa LSD1 are a novel nuclear localization signal and interact with importin alpha. The LSD1-type zinc finger motifs of Pisum sativa LSD1 are a novel nuclear localization signal and interact with importin alpha. PLoS ONE 2011 imex curation He S., Huang K., Zhang X., Yu X., Huang P., An C. chcaian@pku.edu.cn 15-Nov-2012: Contacted by pporras. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence He S., Huang K., Zhang X., Yu X., Huang P., An C. chcaian@pku.edu.cn Accepted 2012-NOV-01 by ORCHARD 15-Nov-2012: Contacted by pporras. PLoS ONE 2011 Only protein-protein interactions imex curation The LSD1-type zinc finger motifs of Pisum sativa LSD1 are a novel nuclear localization signal and interact with importin alpha. The LSD1-type zinc finger motifs of Pisum sativa LSD1 are a novel nuclear localization signal and interact with importin alpha. PLoS ONE 2011 imex curation He S., Huang K., Zhang X., Yu X., Huang P., An C. chcaian@pku.edu.cn 15-Nov-2012: Contacted by pporras. Only protein-protein interactions arath-protoplast Arabidopsis thaliana protoplast Protoplast defined as a membrane-bound cell from which the outer wall has been partially or completely removed. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence He S., Huang K., Zhang X., Yu X., Huang P., An C. chcaian@pku.edu.cn Accepted 2012-NOV-01 by ORCHARD 15-Nov-2012: Contacted by pporras. PLoS ONE 2011 Only protein-protein interactions imex curation impa3_arath Importin subunit alpha-3 IMPA3 KAP2 Karyopherin subunit alpha-2 MOS6 Protein MODIFIER OF SNC1 6 T10M13.16 At4g02150 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLRPSAKTEVRRNRYKVAVDAEEGRRRREDNLVEIRKNKREENLQKKRFTSSMAFGSATGQTEQDLSSANQLKDNLPAMVAGIWSEDSNSQLEATNLLRKLLSIEQNPPINEVVQSGVVPRVVKFLSRDDFPKLQFEAAWALTNIASGTSENTNVIIESGAVPIFIQLLSSASEDVREQAVWALGNVAGDSPKCRDLVLSYGAMTPLLSQFNENTKLSMLRNATWTLSNFCRGKPPPAFEQTQPALPVLERLVQSMDEEVLTDACWALSYLSDNSNDKIQAVIEAGVVPRLIQLLGHSSPSVLIPALRTIGNIVTGDDLQTQMVLDQQALPCLLNLLKNNYKKSIKKEACWTISNITAGNADQIQAVIDAGIIQSLVWVLQSAEFEVKKEAAWGISNATSGGTHDQIKFMVSQGCIKPLCDLLTCPDLKVVTVCLEALENILVVGEAEKNLGHTGEDNLYAQMIDEAEGLEKIENLQSHDNNDIYDKAVKILETFWTEDNEEEGNDENHAPQSGFQFGSTNVPPGQFNFI 55B8979D205FCAA3 impa1_arath Importin subunit alpha-1 IMPA1 KAP1 Karyopherin subunit alpha-1 F3E22.14 T8E24.1 At3g06720 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLRPNAKTEVRRNRYKVAVDAEEGRRRREDNMVEIRKSKREESLMKKRREGMQALQGFPSASAASVDKKLDSLKDMVAGVWSDDPALQLESTTQFRKLLSIERSPPIEEVISAGVVPRFVEFLKKEDYPAIQFEAAWALTNIASGTSDHTKVVIDHNAVPIFVQLLASPSDDVREQAVWALGNVAGDSPRCRDLVLGCGALLPLLNQLNEHAKLSMLRNATWTLSNFCRGKPQPHFDQVKPALPALERLIHSDDEEVLTDACWALSYLSDGTNDKIQTVIQAGVVPKLVELLLHHSPSVLIPALRTVGNIVTGDDIQTQCVINSGALPCLANLLTQNHKKSIKKEACWTISNITAGNKDQIQTVVEANLISPLVSLLQNAEFDIKKEAAWAISNATSGGSHDQIKYLVEQGCIKPLCDLLVCPDPRIITVCLEGLENILKVGEAEKNLGHTGDMNYYAQLIDDAEGLEKIENLQSHDNNEIYEKAVKILETYWLEEEDDETQQPPGVDGSQAGFQFGGNQAPVPSGGFNFS 9425EACB98D585C7 q4u6g1_pea LITAF protein protein pea Pisum sativum (Garden pea) Garden pea MGRKEEEEVAVGVPVYERNGIPPNALIGDPKGIPIQQTIYRDTPAPFNCPHCGHTSLTSVRSKISLAAFVGCLMPMMLGVCFLCPSMDCLWHKYHYCPDCHQKVADFEKSDICAVMDPPNWTQESFALARY BD182A08F54246DE f8rp38_pea protein protein pea Pisum sativum (Garden pea) Garden pea MQSQLVCNGCRNMLLYPRGATNVCCALCNTISPVPPPGMDMSQLYCGGCRTLLMYTRGATSVRCSCCHTVNLAPVSNQVAHVPCANCRTTLMYPYGAPSVKCAVCHYITNINMSNGRVPVPANRPQGTTNLGTLPSTSTSMPQSQGQTVVVENPMSVDSSGKLVSNVVVGVTTDKK 2A923A0ADE2BD4A7 impa4_arath Importin subunit alpha-4 IMPA4 T12M4.2 At1g09270 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSLRPSTRAELRKKIYKTGVDADEARRRREDNLVEIRKNKREDSLLKKRREGMMLQQQLPLGAGLDGPQTAAAVEKRLEGIPMMVQGVYSDDPQAQLEATTQFRKLLSIERSPPIDEVIKAGVIPRFVEFLGRHDHPQLQFEAAWALTNVASGTSDHTRVVIEQGAVPIFVKLLTSASDDVREQAVWALGNVAGDSPNCRNLVLNYGALEPLLAQLNENSKLSMLRNATWTLSNFCRGKPPTPFEQVKPALPILRQLIYLNDEEVLTDACWALSYLSDGPNDKIQAVIEAGVCPRLVELLGHQSPTVLIPALRTVGNIVTGDDSQTQFIIESGVLPHLYNLLTQNHKKSIKKEACWTISNITAGNKLQIEAVVGAGIILPLVHLLQNAEFDIKKEAAWAISNATSGGSHEQIQYLVTQGCIKPLCDLLICPDPRIVTVCLEGLENILKVGEADKEMGLNSGVNLYAQIIEESDGLDKVENLQSHDNNEIYEKAVKILERYWAEEEEEQILQDGGNDNSQQAFNFGNNPAAPVGGFKFA C342198841B87CCA litaf-f8rp38 3 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association text kap1-f8rp38 2 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association 3a ima2-f8rp38-1 2 5 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 3a ima3-f8rp38 2 5 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association 3a impa4-f8rp38 2 8 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association 3a kap1-f8rp38-1 1 6 unspecified role unspecified role bait bait purified purified n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey purified purified zinc finger domain 2-containing region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range zinc finger domain 3-containing region required to bind necessary binding region required to bind range range range range n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range zinc finger domain 1-containing region required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range ecoli Escherichia coli (strain K12) direct interaction direct interaction 3b, 4 f8rp38-kap1 4 6 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 3c