mpidb The Microbial Protein Interaction Database Quantitative proteomic analysis reveals formation of an EscL-EscQ-EscN type III complex in enteropathogenic Escherichia coli. Quantitative proteomic analysis reveals formation of an EscL-EscQ-EscN type III complex in enteropathogenic Escherichia coli. J. Bacteriol. (0021-9193) 2011 imex curation Biemans-Oldehinkel E., Sal-Man N., Deng W., Foster L.J., Finlay B.B. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Biemans-Oldehinkel E., Sal-Man N., Deng W., Foster L.J., Finlay B.B. Accepted 2012-DEC-10 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation Quantitative proteomic analysis reveals formation of an EscL-EscQ-EscN type III complex in enteropathogenic Escherichia coli. Quantitative proteomic analysis reveals formation of an EscL-EscQ-EscN type III complex in enteropathogenic Escherichia coli. J. Bacteriol. (0021-9193) 2011 imex curation Biemans-Oldehinkel E., Sal-Man N., Deng W., Foster L.J., Finlay B.B. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Biemans-Oldehinkel E., Sal-Man N., Deng W., Foster L.J., Finlay B.B. Accepted 2012-DEC-10 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation b7uma6_eco27 Protein-secreting ATPase escN E2348C_3948 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MISEHDSVLEKYPRIQKVLNSTVPALSLNSSTRYEGKIINIGGTIIKARLPKARIGAFYKIEPSQRLAEVIAIDEDEVFLLPFEHVSGMYCGQWLSYQGDEFKIRVGDALLGRLIDGIGRPMESNIVAPYLPFERSLYAEPPDPLLRQVIDQPFILGVRAIDGLLTCGIGQRIGIFAGSGVGKSTLLGMICNGASADIIVLALIGERGREVNEFLALLPQSTLSKCVLVVTTSDRPALERMKAAFTATTIAEYFRDQGKNVLLMMDSVTRYARAARDVGLASGEPDVRGGFPPSVFSSLPKLLERAGPAPKGSITAIYTVLLESDNVNDPIGDEVRSILDGHIVLTRELAEENHFPAIDIGLSASRVMHNVVTSEHLRAAAECKKLIATYKNVELLIRIGEYTMGQDPEADKAIKNRKLIQNFIQQSTKDISSYEKTIESLFKVVA 217501424DC02BB9 b7uma3_eco27 sepQ E2348C_3945 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MKPLSSQLNMKINDFYLPLLPVIGTGRLYITSEGHACHAYFREVSGHGIRFTLTYSGYEGRFWISEEQFIQWCQELFPYSESRLIPEDMIKLMILWVMQTALPEGDVSVDDVQFTMLNKDVYPVIENNNGENRLNVIILETTVQSLQHLINDNWQFVPHSNALFFDGYIVPGWTDYPVTELRVGDSLRLYHVDDSQERRCWIVINNPLATVKLSDNNLSVTDVLAADPLCTISSETVMNRIYCVIGTVHIDIHMLRNVQKDDIIDSTGYHLFGGCQLVRNNTTIAYGSIIKINEDFYFTISVVCD 46AD3D1F7CB0BC5E b7ugf2_eco27 DUF2786 domain-containing protein E2348C_2638 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MKDKYIAKIKKLLRLAKGTSSPEEAANAIAKAQAYMRQHGISENDAELFDIQEAASAGAPSDASTPPRYMHILCDLVCKAFGVECYISGEYRASGSLKRYVRFYGPDSRPEIAAYAFDVLSRQMMAERKKYQDKHCKRCGPSTRVARGDQFCEGWVFGARDVIAVYDVSPEEKSRLELYRKNLHSTKGLRDGDMRTAKACRGAEFAATAGFIAGKNARLHQGVNGQSNRPLALGRV 33DCCA6FA6CF17A7 escn-b7ugf2-1 2 3 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association figure 2 escl-sepq 2 4 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey association association figure 2 b7ugf2-escn 2 3 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association figure 2 b7ugf2-escn 1 3 unspecified role unspecified role prey prey hsv tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 3A b7ugf2-sepq 1 4 unspecified role unspecified role prey prey hsv tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 3B sepq-escn 1 3 unspecified role unspecified role prey prey hsv tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait physical association physical association figure 3C, 4 Interaction observed in ESCL -/- cells.