mpidb The Microbial Protein Interaction Database RNase Y in Bacillus subtilis: a Natively disordered protein that is the functional equivalent of RNase E from Escherichia coli. RNase Y in Bacillus subtilis: a Natively disordered protein that is the functional equivalent of RNase E from Escherichia coli. J. Bacteriol. (0021-9193) 2011 imex curation Lehnik-Habrink M., Newman J., Rothe F.M., Solovyova A.S., Rodrigues C., Herzberg C., Commichau F.M., Lewis R.J., Stulke J. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions bacsu Bacillus subtilis anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Lehnik-Habrink M., Newman J., Rothe F.M., Solovyova A.S., Rodrigues C., Herzberg C., Commichau F.M., Lewis R.J., Stulke J. Accepted 2012-DEC-10 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation RNase Y in Bacillus subtilis: a Natively disordered protein that is the functional equivalent of RNase E from Escherichia coli. RNase Y in Bacillus subtilis: a Natively disordered protein that is the functional equivalent of RNase E from Escherichia coli. J. Bacteriol. (0021-9193) 2011 imex curation Lehnik-Habrink M., Newman J., Rothe F.M., Solovyova A.S., Rodrigues C., Herzberg C., Commichau F.M., Lewis R.J., Stulke J. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Lehnik-Habrink M., Newman J., Rothe F.M., Solovyova A.S., Rodrigues C., Herzberg C., Commichau F.M., Lewis R.J., Stulke J. Accepted 2012-DEC-10 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation RNase Y in Bacillus subtilis: a Natively disordered protein that is the functional equivalent of RNase E from Escherichia coli. RNase Y in Bacillus subtilis: a Natively disordered protein that is the functional equivalent of RNase E from Escherichia coli. J. Bacteriol. (0021-9193) 2011 imex curation Lehnik-Habrink M., Newman J., Rothe F.M., Solovyova A.S., Rodrigues C., Herzberg C., Commichau F.M., Lewis R.J., Stulke J. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions bacsu Bacillus subtilis molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Lehnik-Habrink M., Newman J., Rothe F.M., Solovyova A.S., Rodrigues C., Herzberg C., Commichau F.M., Lewis R.J., Stulke J. Accepted 2012-DEC-10 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation RNase Y in Bacillus subtilis: a Natively disordered protein that is the functional equivalent of RNase E from Escherichia coli. RNase Y in Bacillus subtilis: a Natively disordered protein that is the functional equivalent of RNase E from Escherichia coli. J. Bacteriol. (0021-9193) 2011 imex curation Lehnik-Habrink M., Newman J., Rothe F.M., Solovyova A.S., Rodrigues C., Herzberg C., Commichau F.M., Lewis R.J., Stulke J. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions bacsu Bacillus subtilis solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Lehnik-Habrink M., Newman J., Rothe F.M., Solovyova A.S., Rodrigues C., Herzberg C., Commichau F.M., Lewis R.J., Stulke J. Accepted 2012-DEC-10 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation pnp_bacsu Polyribonucleotide nucleotidyltransferase pnp comR pnpA Polynucleotide phosphorylase Vegetative protein 15 BSU16690 protein protein bacsu Bacillus subtilis MGQEKHVFTIDWAGRTLTVETGQLAKQANGAVMIRYGDTAVLSTATASKEPKPLDFFPLTVNYEERLYAVGKIPGGFIKREGRPSEKAVLASRLIDRPIRPLFADGFRNEVQVISIVMSVDQNCSSEMAAMFGSSLALSVSDIPFEGPIAGVTVGRIDDQFIINPTVDQLEKSDINLVVAGTKDAINMVEAGADEVPEEIMLEAIMFGHEEIKRLIAFQEEIVAAVGKEKSEIKLFEIDEELNEKVKALAEEDLLKAIQVHEKHAREDAINEVKNAVVAKFEDEEHDEDTIKQVKQILSKLVKNEVRRLITEEKVRPDGRGVDQIRPLSSEVGLLPRTHGSGLFTRGQTQALSVCTLGALGDVQILDGLGVEESKRFMHHYNFPQFSVGETGPMRGPGRREIGHGALGERALEPVIPSEKDFPYTVRLVSEVLESNGSTSQASICASTLAMMDAGVPIKAPVAGIAMGLVKSGEHYTVLTDIQGMEDALGDMDFKVAGTEKGVTALQMDIKIEGLSREILEEALQQAKKGRMEILNSMLATLSESRKELSRYAPKILTMTINPDKIRDVIGPSGKQINKIIEETGVKIDIEQDGTIFISSTDESGNQKAKKIIEDLVREVEVGQLYLGKVKRIEKFGAFVEIFSGKDGLVHISELALERVGKVEDVVKIGDEILVKVTEIDKQGRVNLSRKAVLREEKEKEEQQS 427F1C172FEC372A csha_bacsu DEAD-box ATP-dependent RNA helicase CshA cshA ydbR BSU04580 protein protein bacsu Bacillus subtilis MTITFQDFNLSSDLMKAINRMGFEEATPIQAQTIPLGLSNKDVIGQAQTGTGKTAAFGIPLVEKINPESPNIQAIVIAPTRELAIQVSEELYKIGQDKRAKVLPIYGGQDIGRQIRALKKNPNIIVGTPGRLLDHINRRTIRLNNVNTVVMDEADEMLNMGFIDDIESILSNVPSEHQTLLFSATMPAPIKRIAERFMTEPEHVKVKAKEMTVSNIQQFYLEVQERKKFDTLTRLLDIQSPELAIVFGRTKRRVDELAEALNLRGYAAEGIHGDLTQAKRMVALRKFKEGAIEVLVATDVAARGLDISGVTHVYNFDVPQDPESYVHRIGRTGRAGKTGMAMTFITPREKSMLRAIEQTTKRKMDRMKEPTLDEALEGQQQVTVERLRTTISENNLNFYMTAAAELLEDHDAVTVVAAAIKMATKEPDDTPVRLTDEAPMVSKRYKNQRSSKRRDGQGGGYRGGKGKSNNRSSYDKKRSNDRRSSGDRRQKKSY A44C5EAE314E46ED rny_bacsu Ribonuclease Y rny ymdA BSU16960 protein protein bacsu Bacillus subtilis MTPIMMVLISILLILLGLVVGYFVRKTIAEAKIAGARGAAEQILEDAKRDAEALKKEALLEAKDEIHKLRIDAEQEVRERRNELQKQENRLLQKEENLDRKHEGIDKREAMLEKKDHSLNERQQHIEEMESKVDEMIRMQQSELERISSLTRDEAKQIILERVENELSHDIAIMTKETENRAKEEADKKAKNILSLALQRCAADHVAETTVSVVNLPNDEMKGRIIGREGRNIRTLETLTGIDLIIDDTPEAVILSGFDPIRRETARIALDKLVQDGRIHPARIEEMVEKSRREVDDYIREMGEQTTFEVGVHGLHPDLIKILGRLKFRTSYGQNVLKHSMEVAFLAGLMASELGEDAKLAKRAGLLHDIGKAIDHEVEGSHVEIGVELATKYKEHPVVINSIASHHGDEEPTSIIAVLVAAADALSAARPGARSETLENYIRRLEKLEEISESYEGVEKSFAIQAGREVRIMVKPDSINDLEAHRLARDIRKRIEDELDYPGHIKVTVIRETRAVEYAK C137937C7665C58C rnj1_bacsu Ribonuclease J1 rnjA ykqC BSU14530 protein protein bacsu Bacillus subtilis MKFVKNDQTAVFALGGLGEIGKNTYAVQFQDEIVLIDAGIKFPEDELLGIDYVIPDYTYLVKNEDKIKGLFITHGHEDHIGGIPYLLRQVNIPVYGGKLAIGLLRNKLEEHGLLRQTKLNIIGEDDIVKFRKTAVSFFRTTHSIPDSYGIVVKTPPGNIVHTGDFKFDFTPVGEPANLTKMAEIGKEGVLCLLSDSTNSENPEFTMSERRVGESIHDIFRKVDGRIIFATFASNIHRLQQVIEAAVQNGRKVAVFGRSMESAIEIGQTLGYINCPKNTFIEHNEINRMPANKVTILCTGSQGEPMAALSRIANGTHRQISINPGDTVVFSSSPIPGNTISVSRTINQLYRAGAEVIHGPLNDIHTSGHGGQEEQKLMLRLIKPKFFMPIHGEYRMQKMHVKLATDCGIPEENCFIMDNGEVLALKGDEASVAGKIPSGSVYIDGSGIGDIGNIVLRDRRILSEEGLVIVVVSIDMDDFKISAGPDLISRGFVYMRESGDLINDAQELISNHLQKVMERKTTQWSEIKNEITDTLAPFLYEKTKRRPMILPIIMEV 48091B448B8431C9 48091B448B8431C9 rnj2_bacsu Ribonuclease J2 rnjB ymfA BSU16780 protein protein bacsu Bacillus subtilis MKKKNTENVRIIALGGVGEIGKNLYVIEIDSDIFVVDAGLMHPENEMLGIDVVIPDISYLIERADRVKAIFLTHGHDENIGGVFYLLNKLSVPVYGTKLTLALLREKLKQYGHNRKTDLREIHSKSVITFESTKVSFFRTIHSIPDSVGVSFKTSLGSIVCTGDFKFDQTPALNQTCDIGEIAKIGNSGVLALLSDSANAERPGYTPSEAAVSGEISDALYNSQNRVIIAVFASNINRIQQVIHAAAQNGRKIAVAGKNLQSVLQLARKLGYIEADDELFISVQDVKKYPKREVAIITAGSQGEPLAALTRMANKAHKQLNIEEGDTVVIASTPIPGQELIYSKTVDLLARAGAQVIFAQKRVHVSGHGSQEELKLMINLLKPKYLIPVNGEYRMQKAHSKIAEETGMKRSDIFLIEKGDVVEFRGQNVKIGDKVPYGNILIDGLGVGDIGNIVLRDRRLLSQDGILIVVITLDKQKKHLVSGPEIITRGFVYVRESEGLIVQATELVRSIVTEATETSNVEWSTLKQAMRDALNQFLYEKTKRKPMIIPIIMEV 8EA92EE42D51F282 8EA92EE42D51F282 eno_bacsu Enolase eno 2-phospho-D-glycerate hydro-lyase 2-phosphoglycerate dehydratase BSU33900 protein protein bacsu Bacillus subtilis MPYIVDVYAREVLDSRGNPTVEVEVYTETGAFGRALVPSGASTGEYEAVELRDGDKDRYLGKGVLTAVNNVNEIIAPELLGFDVTEQNAIDQLLIELDGTENKGKLGANAILGVSMACARAAADFLQIPLYQYLGGFNSKTLPVPMMNIVNGGEHADNNVDIQEFMIMPVGAPNFREALRMGAQIFHSLKSVLSAKGLNTAVGDEGGFAPNLGSNEEALQTIVEAIEKAGFKPGEEVKLAMDAASSEFYNKEDGKYHLSGEGVVKTSAEMVDWYEELVSKYPIISIEDGLDENDWEGHKLLTERLGKKVQLVGDDLFVTNTKKLSEGIKNGVGNSILIKVNQIGTLTETFDAIEMAKRAGYTAVISHRSGETEDSTIADIAVATNAGQIKTGAPSRTDRVAKYNQLLRIEDQLAETAQYHGINSFYNLNK C82B60F49D11AE68 pfka_bacsu ATP-dependent 6-phosphofructokinase pfkA pfk Phosphohexokinase BSU29190 protein protein bacsu Bacillus subtilis MKRIGVLTSGGDSPGMNAAVRAVVRKAIYHDVEVYGIYNGYAGLISGKIEKLELGSVGDIIHRGGTKLYTARCPEFKTVEGREKGIANLKKLGIEGLVVIGGDGSYMGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWAGLAGGAESILIPEADYDMHEIIARLKRGHERGKKHSIIIVAEGVGSGVEFGKRIEEETNLETRVSVLGHIQRGGSPSAADRVLASRLGAYAVELLLEGKGGRCVGIQNNKLVDHDIIEILETKHTVEQNMYQLSKELSI 706CBC7F9BCFCDFC rny-rny-5 3 7 unspecified role unspecified role neutral component neutral component c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role neutral component neutral component c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range direct interaction direct interaction Figure 3A rny-rny-6 4 7 unspecified role unspecified role neutral component neutral component region strep tag strep tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction figures 3B and 3C rny-pnp 2 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait tm region O31774-5-30 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain c-terminal O31774-430-520 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association figure 8 rny-eno-1 2 7 unspecified role unspecified role bait bait c-terminal O31774-430-520 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain tm region O31774-5-30 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role prey prey physical association physical association figure 8 rny-pfka 2 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region O31774-5-30 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain c-terminal region O31774-430-520 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association figure 8 rny-csha 2 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait tm region O31774-5-30 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain c-terminal region O31774-430-520 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association figure 8 rny-rnja 2 8 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait tm region O31774-5-30 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain c-terminal region O31774-430-520 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association figure 8 rny-rny-4 2 7 unspecified role unspecified role prey prey c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range coiled coil region O31774-30-150 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain tm region O31774-5-30 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait coiled coil region 3 prime overhang 3 prime overhang 3 prime sticky end certain certain sequence position certain certain certain sequence position certain c-terminal strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range tm region O31774-5-30 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 48 51 49 53 physical association physical association figure 6 pnp-rny 1 5 unspecified role unspecified role bait bait p50849-- P50849-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey c-terminal O31774-- strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association figure 7 eno-rny-1 1 10 unspecified role unspecified role bait bait p37869-- P37869-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey c-terminal O31774-- strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association figure 7 pfka-rny 1 11 unspecified role unspecified role bait bait o34529-- O34529-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey c-terminal O31774-- strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association figure 7 csha-rny 1 6 unspecified role unspecified role bait bait p96614-- P96614-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey c-terminal O31774-- strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association figure 7 rnjb-rny 1 7 unspecified role unspecified role prey prey c-terminal O31774-- strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 unspecified role unspecified role bait bait o31760-- O31760-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 7 rnja-rny 1 8 unspecified role unspecified role bait bait q45493-- Q45493-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey c-terminal O31774-- strep tag strep tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association figure 7 rny-1 4 7 unspecified role unspecified role neutral component neutral component region strep tag strep tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction figures 3B and 3C