I2D I2D The tumor-suppressor gene ARHI (DIRAS3) suppresses ovarian cancer cell migration through inhibition of the Stat3 and FAK/Rho signaling pathways. The tumor-suppressor gene ARHI (DIRAS3) suppresses ovarian cancer cell migration through inhibition of the Stat3 and FAK/Rho signaling pathways. Oncogene (0950-9232) 2012 imex curation Badgwell D.B., Lu Z., Le K., Gao F., Yang M., Suh G.K., Bao J.J., Das P., Andreeff M., Chen W., Yu Y., Ahmed A.A., S-L Liao W., Bast R.C. Cancer - Interactions investigated in the context of cancer The cells used were a sub-line of SKOv3 with a Tet-on inducible expression of ARHI (SKOv3-ARHI), inducible with Doxycycline. The cells used were a sub-line of SKOv3 with a Tet-on inducible expression of ARHI (SKOv3-ARHI), inducible with Doxycycline. rbast@mdanderson.org 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-skov_3 Homo sapiens ovarian adenocarcinoma cell line skov_3 Human ovarian adenocarcinoma cell line Derived from the ascitic fluid from a 64 year old caucasian female with an ovarian tumour. Forms moderately well-differentiated adenocarcinoma consistent with ovarian primary cells. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Badgwell D.B., Lu Z., Le K., Gao F., Yang M., Suh G.K., Bao J.J., Das P., Andreeff M., Chen W., Yu Y., Ahmed A.A., S-L Liao W., Bast R.C. Cancer - Interactions investigated in the context of cancer The cells used were a sub-line of SKOv3 with a Tet-on inducible expression of ARHI (SKOv3-ARHI), inducible with Doxycycline. The cells used were a sub-line of SKOv3 with a Tet-on inducible expression of ARHI (SKOv3-ARHI), inducible with Doxycycline. rbast@mdanderson.org Accepted 2012-AUG-07 by MGT 19-Sept-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database The tumor-suppressor gene ARHI (DIRAS3) suppresses ovarian cancer cell migration through inhibition of the Stat3 and FAK/Rho signaling pathways. The tumor-suppressor gene ARHI (DIRAS3) suppresses ovarian cancer cell migration through inhibition of the Stat3 and FAK/Rho signaling pathways. Oncogene (0950-9232) 2012 imex curation Badgwell D.B., Lu Z., Le K., Gao F., Yang M., Suh G.K., Bao J.J., Das P., Andreeff M., Chen W., Yu Y., Ahmed A.A., S-L Liao W., Bast R.C. Cancer - Interactions investigated in the context of cancer The cells used were a sub-line of SKOv3 with a Tet-on inducible expression of ARHI (SKOv3-ARHI), inducible with Doxycycline. The cells used were a sub-line of SKOv3 with a Tet-on inducible expression of ARHI (SKOv3-ARHI), inducible with Doxycycline. rbast@mdanderson.org 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions Curated by: I2D - Interologous Interaction Database human-skov_3 Homo sapiens ovarian adenocarcinoma cell line skov_3 Human ovarian adenocarcinoma cell line Derived from the ascitic fluid from a 64 year old caucasian female with an ovarian tumour. Forms moderately well-differentiated adenocarcinoma consistent with ovarian primary cells. confocal microscopy confocal microscopy immunostaining immunostaining Badgwell D.B., Lu Z., Le K., Gao F., Yang M., Suh G.K., Bao J.J., Das P., Andreeff M., Chen W., Yu Y., Ahmed A.A., S-L Liao W., Bast R.C. Cancer - Interactions investigated in the context of cancer The cells used were a sub-line of SKOv3 with a Tet-on inducible expression of ARHI (SKOv3-ARHI), inducible with Doxycycline. The cells used were a sub-line of SKOv3 with a Tet-on inducible expression of ARHI (SKOv3-ARHI), inducible with Doxycycline. rbast@mdanderson.org Accepted 2012-AUG-07 by MGT 19-Sept-2012: Contacted by IntAct-Help. Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database dira3_human GTP-binding protein Di-Ras3 DIRAS3 ARHI NOEY2 RHOI Distinct subgroup of the Ras family member 3 Rho-related GTP-binding protein RhoI protein protein human Homo sapiens Human MGNASFGSKEQKLLKRLRLLPALLILRAFKPHRKIRDYRVVVVGTAGVGKSTLLHKWASGNFRHEYLPTIENTYCQLLGCSHGVLSLHITDSKSGDGNRALQRHVIARGHAFVLVYSVTKKETLEELKAFYELICKIKGNNLHKFPIVLVGNKSDDTHREVALNDGATCAMEWNCAFMEISAKTDVNVQELFHMLLNYKKKPTTGLQEPEKKSQMPNTTEKLLDKCIIM 16AEA60089A91B3F stat3_human Signal transducer and activator of transcription 3 Acute-phase response factor STAT3 APRF protein protein human Homo sapiens Human MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM 6C00632211C8012D DIP protein P40763 original sequence version: 157 DIP protein P40763-1 original sequence version: 147 DIP protein P40763-1 original sequence version: 135 DIP protein P40763-1 original sequence version: 157 DIP protein P40763 original sequence version: 165 DIP protein P40763 original sequence version: 182 DIP protein P40763 original sequence version: 135 6C00632211C8012D stat3-diras3 1 4 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association 3a diras3-stat3 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association 3a diras3-stat3-1 2 3 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component colocalization colocalization 3c Doxycycline was used to induce ARHI expression, and IL-6 stimulation for 30 mins was used to activate Stat3. Expression of ARHI prevented Stat3 nuclear localisation resulting in both their colocalisation in the cytoplasm.