UniProt UniProt http://www.uniprot.org A novel mouse synaptonemal complex protein is essential for loading of central element proteins, recombination, and fertility. A novel mouse synaptonemal complex protein is essential for loading of central element proteins, recombination, and fertility. PLoS Genet. (1553-7390) 2011 imex curation Schramm S., Fraune J., Naumann R., Hernandez-Hernandez A., Hoog C., Cooke H.J., Alsheimer M., Benavente R. benavente@biozentrum.uni-wuerzburg.de, alsheimer@biozentrum.uni-wuerzburg.de 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Schramm S., Fraune J., Naumann R., Hernandez-Hernandez A., Hoog C., Cooke H.J., Alsheimer M., Benavente R. benavente@biozentrum.uni-wuerzburg.de, alsheimer@biozentrum.uni-wuerzburg.de Accepted 2012-MAY-31 by ORCHARD PLoS Genet. (1553-7390) 2011 Only protein-protein interactions imex curation syce2_mouse Synaptonemal complex central element protein 2 Syce2 Central element synaptonemal complex protein 1 Cesc1 protein protein mouse Mus musculus Mouse MERHGVAAPPVELKDQEPPAIVESGEHRQSENHEETPGSVAPSASCQLPGPFSSLDSSIETLKKKAQELIENINESRQKDHALMTNFRDSLKMKVSDLTEKLEERMYQVYSHHSKIIQERLQEFTQKMAKINHLEMELKQVCQTVETVYKDLCVQSEVPTCEEQNYKDGEC B0517F1D9B8BF9F6 syce1_mouse Synaptonemal complex central element protein 1 Syce1 protein protein mouse Mus musculus Mouse MATRPQPLGMEPEGSADLLHGPEGARGQYGSTQKIEDLMDMVKKLQKVGSLEPRIEVLINRINEVQQAKKKASEELGEAQTVWDNLQKELDLLREEKVRLKDILNRKEETLRIMQLHCQEKESEAQRKHSMLQECKERISFLNSQIDKEKAKLRKLRLDFEEHLETLMSQHKDTLEFHKPEHLTKEMCVLDSSKEQLLKEEKLMKVKLEDVRQRLCALGGPEGSSSLIEGLFLRSHEAAAAMQMFKDENKKAEEFLEAAAQQHEQLQQRCHQLQQKRQRLKEELEKHGVQILAHSTQNEEDSSWRMASPKPVEVHEETAQDQERPSSRT E843B245EDE1C029 syce3_mouse Synaptonemal complex central element protein 3 Syce3 Tseg2 Testis-specific expressed protein 2 protein protein mouse Mus musculus Mouse MADSDPGERSYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFLNCKEEMEKNWQELLTETKRKQ A681AB78783046DD syce3-syce1 1 4 unspecified role unspecified role bait bait myc-syce3 myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey egfp-syce1 egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 10 A syce1-syce3 1 4 unspecified role unspecified role prey prey myc-syce3 myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait egfp-syce1 egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 10B syce3-syce2 1 2 unspecified role unspecified role prey prey egfp-syce2 egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait myc-syce3 myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 10 C syce2-syce3 1 2 unspecified role unspecified role bait bait egfp-syce2 egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey myc-syce3 myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figure 10 D