UniProt UniProt http://www.uniprot.org The Caenorhabditis elegans GARP complex contains the conserved Vps51 subunit and is required to maintain lysosomal morphology. The Caenorhabditis elegans GARP complex contains the conserved Vps51 subunit and is required to maintain lysosomal morphology. Mol. Biol. Cell (1059-1524) 2011 imex curation Luo L., Hannemann M., Koenig S., Hegermann J., Ailion M., Cho M.K., Sasidharan N., Zweckstetter M., Rensing S.A., Eimer S. Positive / negative controls from yeast-two hybrid experiments depicted in figure 8A were not added as there is no information in the text about the organism background. Colocalization experiments from figure 3a were not added since they were intended for subcellular localization purposes seimer@gwdg.de 09-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions caeel-body muscle Caenorhabditis elegans body muscle body_muscle Body wall muscle confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Luo L., Hannemann M., Koenig S., Hegermann J., Ailion M., Cho M.K., Sasidharan N., Zweckstetter M., Rensing S.A., Eimer S. Positive / negative controls from yeast-two hybrid experiments depicted in figure 8A were not added as there is no information in the text about the organism background. Colocalization experiments from figure 3a were not added since they were intended for subcellular localization purposes seimer@gwdg.de Accepted 2013-AUG-05 by PPORRAS 09-Aug-2013: Contacted by IntAct-Help. Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation The Caenorhabditis elegans GARP complex contains the conserved Vps51 subunit and is required to maintain lysosomal morphology. The Caenorhabditis elegans GARP complex contains the conserved Vps51 subunit and is required to maintain lysosomal morphology. Mol. Biol. Cell (1059-1524) 2011 imex curation Luo L., Hannemann M., Koenig S., Hegermann J., Ailion M., Cho M.K., Sasidharan N., Zweckstetter M., Rensing S.A., Eimer S. Positive / negative controls from yeast-two hybrid experiments depicted in figure 8A were not added as there is no information in the text about the organism background. Colocalization experiments from figure 3a were not added since they were intended for subcellular localization purposes seimer@gwdg.de 09-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions caeel Caenorhabditis elegans confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Luo L., Hannemann M., Koenig S., Hegermann J., Ailion M., Cho M.K., Sasidharan N., Zweckstetter M., Rensing S.A., Eimer S. Positive / negative controls from yeast-two hybrid experiments depicted in figure 8A were not added as there is no information in the text about the organism background. Colocalization experiments from figure 3a were not added since they were intended for subcellular localization purposes seimer@gwdg.de Accepted 2013-AUG-05 by PPORRAS 09-Aug-2013: Contacted by IntAct-Help. Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation The Caenorhabditis elegans GARP complex contains the conserved Vps51 subunit and is required to maintain lysosomal morphology. The Caenorhabditis elegans GARP complex contains the conserved Vps51 subunit and is required to maintain lysosomal morphology. Mol. Biol. Cell (1059-1524) 2011 imex curation Luo L., Hannemann M., Koenig S., Hegermann J., Ailion M., Cho M.K., Sasidharan N., Zweckstetter M., Rensing S.A., Eimer S. Positive / negative controls from yeast-two hybrid experiments depicted in figure 8A were not added as there is no information in the text about the organism background. Colocalization experiments from figure 3a were not added since they were intended for subcellular localization purposes seimer@gwdg.de 09-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions caeel-neuron Caenorhabditis elegans neuron neuron Neuron [Neuronal cell; Neural cell confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Luo L., Hannemann M., Koenig S., Hegermann J., Ailion M., Cho M.K., Sasidharan N., Zweckstetter M., Rensing S.A., Eimer S. Positive / negative controls from yeast-two hybrid experiments depicted in figure 8A were not added as there is no information in the text about the organism background. Colocalization experiments from figure 3a were not added since they were intended for subcellular localization purposes seimer@gwdg.de Accepted 2013-AUG-05 by PPORRAS 09-Aug-2013: Contacted by IntAct-Help. Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation The Caenorhabditis elegans GARP complex contains the conserved Vps51 subunit and is required to maintain lysosomal morphology. The Caenorhabditis elegans GARP complex contains the conserved Vps51 subunit and is required to maintain lysosomal morphology. Mol. Biol. Cell (1059-1524) 2011 imex curation Luo L., Hannemann M., Koenig S., Hegermann J., Ailion M., Cho M.K., Sasidharan N., Zweckstetter M., Rensing S.A., Eimer S. Positive / negative controls from yeast-two hybrid experiments depicted in figure 8A were not added as there is no information in the text about the organism background. Colocalization experiments from figure 3a were not added since they were intended for subcellular localization purposes seimer@gwdg.de 09-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions caeel Caenorhabditis elegans anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Luo L., Hannemann M., Koenig S., Hegermann J., Ailion M., Cho M.K., Sasidharan N., Zweckstetter M., Rensing S.A., Eimer S. Positive / negative controls from yeast-two hybrid experiments depicted in figure 8A were not added as there is no information in the text about the organism background. Colocalization experiments from figure 3a were not added since they were intended for subcellular localization purposes seimer@gwdg.de Accepted 2013-AUG-05 by PPORRAS 09-Aug-2013: Contacted by IntAct-Help. Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation The Caenorhabditis elegans GARP complex contains the conserved Vps51 subunit and is required to maintain lysosomal morphology. The Caenorhabditis elegans GARP complex contains the conserved Vps51 subunit and is required to maintain lysosomal morphology. Mol. Biol. Cell (1059-1524) 2011 imex curation Luo L., Hannemann M., Koenig S., Hegermann J., Ailion M., Cho M.K., Sasidharan N., Zweckstetter M., Rensing S.A., Eimer S. Positive / negative controls from yeast-two hybrid experiments depicted in figure 8A were not added as there is no information in the text about the organism background. Colocalization experiments from figure 3a were not added since they were intended for subcellular localization purposes seimer@gwdg.de 09-Aug-2013: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Luo L., Hannemann M., Koenig S., Hegermann J., Ailion M., Cho M.K., Sasidharan N., Zweckstetter M., Rensing S.A., Eimer S. Positive / negative controls from yeast-two hybrid experiments depicted in figure 8A were not added as there is no information in the text about the organism background. Colocalization experiments from figure 3a were not added since they were intended for subcellular localization purposes seimer@gwdg.de Accepted 2013-AUG-05 by PPORRAS 09-Aug-2013: Contacted by IntAct-Help. Mol. Biol. Cell (1059-1524) 2011 Only protein-protein interactions imex curation stx5_caeel Putative syntaxin-5 syx-5 syn-3 F55A11.2 protein protein caeel Caenorhabditis elegans MSDFHNIRSRRRIPEASSYSTVDFDYDPDQKNHTSAVAPTSFAYSSLTTVFNASASQLWNSAQEALVSSYDTAEGTESIDADRSKVVETLESLSIFGNPLDHIIITMPSRDRTSEFRATAKSYEMKAAANGIRPQPKHEMLSESVQFNQLAKRIGKELSQTCAKMEKLAEYAKKKSCYEERSQIDHLSSIVKSDITGLNKQIGQLQEFSKRRAGNMKNQNSGHIQLVVVGLQSKLANVGKDYQSVLEISTETMKAEKNRRDKFSSGAAVPMGLPSSSSGANVRSKLLQDDEQHGSSSIALDMGALSNMQSQQTMQQRDSSLEYAQARSNTMATIEGSISELGQIFSQLASLVSEQGEMITRIDSNVEDTALNIDMAHSELVRYLQNISKNRWLMIQVFGVLMVFFVVFVLFLT 41DB9C1634BC493A cut19_caeel Cuticlin-like protein 19 cutl-19 syx-16 ZC155.5 protein protein caeel Caenorhabditis elegans MVEYNRIFCVLVIFSTTIKCEYSELMNQKIGVRVEVLNMIYENETTITSTGHPRCRLTLHKSGWDRDTCSSPQFKLNDTLSWSTRVCYKWVCDTTKYAMRVESCWIGSPNMSVYILRDDGCTIEKAILTSPVYTSFNRAAAIGWMAVRQKNMKYMHVGCTIRLCHLCDPKCQTITPPRTCNDNRADDYEAMWNSSSRVKNLCFPEPSTTENLNLNFGNSPFQNVGNIIILLLVFLLR F4854B91B88008B7 vps54_caeel Vacuolar protein sorting-associated protein 54 vps-54 T21C9.2 protein protein caeel Caenorhabditis elegans MKSMDDRTVGLISASSSRASLKIQPEIGYPRICDYCQPIIELMTASEFARHIRQDHTTKEGGSFLCRYGEHGVCQKLPLEGVCDLDFEAHIRRCHTSSQPAGYSSPTSSLVASYTEDSEETASLRSIRLTSDRDTPTIEKKKFTLHSFTQNLSAVLADPSRSRSDLTTFFTRHWGDSFVPTQPVPQSKRLARLADSAFDSYCQSAGESYRRYQAIKRALRLSHADGGVGIGDERQDAEDLPTIFIDPRFTLGDSSTFSDVFTVPANDDLDALKQTLSGRNVIPATPLEIATNRKPGEFRDYEALQNRLEMMHDVVDGRLAGKLVAKTDDFWQVVRSYSGLQEQLANALQCVMVVRKNLKRVDELVCDQSKKIVEVHERYEQKKKLLAKLHDISCLREAQSTVQMMLSQGDYPKAIECIETSLDVLSKELNGVTCFRHLASQLRELYTVIGRMMNEDFASLIQKELGVKPEAGTMIQAEGELSAVLLGLMRMRKYSFIAVLREEIIEGVKSVMRQVIKNQILNNGVDLNDFDPSLTQLGEPVRRMKHADFLKTVKAVMDEEFYFCKRLEALQDILLETVERANPLHRHGSEDIIVERIEEAKDIHESESDDEVGTTFSKSASSGGFSVGGSALSSNASATTLLSIEVRSEAFLRHVLPLIAEFGHQCAQQRISRLLIARAKNASVTEATTPTQLSECIKLVKEFQSKCDKEGWYSTQNQKVGGLGRSVNKLSMDYIEKFHAARKIRIGNMLDTELWKATDVSIVDQNIVDMAMETGQLRNTKRIDDGPIKKSFKRTESAVTIDSTTSTSNQIQGVIVDEENYVVVGSSITMIQLLSDYCEAISEMPSFSQDWNSRVVELLKTFNSRCCQLILGAGALQLVGLKTISVRNLALAGRSLELVCRFIPMVHDEMDRVLPENRKSLLRYFKQVESEYRDHVNEIAAKLISVIAHYTTNCLGMWDVKGVIPSPEFQQICRHMLKFHNGLVGIMPRDQIEALFRQVHENFKANLREHVTGMGITPHDPLKYGYVTKDYMFYQQNVKNMESCRNLELESLNDIMFE C65EF22D698C8702 o18230_caeel vti-1 Y57G11C.4 CELE_Y57G11C.4 protein protein caeel Caenorhabditis elegans MSNQSATVEQLSGFEKQYSLQTAEITSKIGRVHTLPSSDRAGAVQEIRKSLEEVNDLLDQMELVVRELESNTTERTKYELRVRSYQSDKKQLDTELEKAIKRVREEADRDELLAFDDQLDEHRQEDQLIANTQRLERSTRKVQDAHRIAVETEQIGAEMLSNLASQRETIGRSRDRLRQSNADLGRANKTLSSMIRRAIQNRLLLLIVTFLLSFMFLYIVYKAI 84615AFDE1335E2D vps52_caeel Vacuolar protein sorting-associated protein 52 homolog vps-52 tag-197 F08C6.3 protein protein caeel Caenorhabditis elegans MPRTRVNLQKSEANDRSFTISSLEFCLSQLRKADPNLVKKAIASGDGLTESKNDVSTRLSEAHRYSVQQCLDNSEQLAQLHNQLVHCDNVFERLQATLYSFQDNLGSIGQDMKNLQLQSHHIHQELENRQKVRVELSQFVDDIAVSQTMMKTINDTDANDRGFLEALHELHHKITLILQRGNGDAVAVNDTMPILEGLKLKAVVKVREWLLQKMFQFRKPLSNYQVFQHQLLKCRFFYEFLLHHDLISAKELQDEYIDTISKMFFTYFKAYATRLFKLAMKDVATKEDALGSIDFAKPAGLGAIFSSKQHVVRNKATVFSIGQRHQILSDDFLGALIVPHAATQNHQSYQFEALFRSIQLAFVDHYSHEYLFITDFFLVSNDEAIELHNKAMARAMSVVLKSCEEQIALSWDAISLHLCICLCDKFTEVLAEREVPEVSDYWNTVTSFLWTRLNLVMSQHYESVKSVDLKKLMHSGSLDARPHFIVRRYAELTSAHLMIAKASGKEMGAKMEAVLENSEDSIEQLLTRMSAMQQTQKNKHVFLINNYDLILSIIDNEESKHTKIYAIVHELEQKSIDDFVEEMLEPHIGYMIKFVNECESLIVQGHTQLLVRYNDKVGTVVANFNAKWRPAVDSINSECIQLFTNFSLGTTILQTIFTKYVQYINRFTKILSHDVFAKNPVCSQLVNVHQVMLEIKRFKPAY ED057C30BA432C75 q21499_caeel M03E7.5 memb-2 CELE_M03E7.5 protein protein caeel Caenorhabditis elegans MDTQLKATREEIDNVQLLLIAIERQTGNHEVDRLIQDANSSLMKTETHMFRLESQLGREPAPVRQKASFKMDQLKSDVCLIKNSLRTMTNRHTNRKKQAEEKKALLKQRFTTNQETRVNLEFDEELNLNDKLKYSDNMIDQMLAQGASVFEDLQKQKYNLLSIRKRFHFLTKSLGISDTTIRLIEKRVREDKKLFMIGVICCLIFMFCFYYWWQYC 5E8C5FFB7C51E99E vps53_caeel Vacuolar protein sorting-associated protein 53 homolog vps-53 T05G5.8 protein protein caeel Caenorhabditis elegans MEEPTTSELKLSDNVMNEISDMCITEYCKPNMSLMAQINELFPTEQSLTQLDSIIASVEGEIGELDNELAYLVETNANVSERGEEALKHAQDAMIELEKSIGSIRERTKSSDEIVREMTRDIKQLDIAKRNLTASITTLHHLHILLTGVESLGAWVDKKDYSSIARQLPAILNVLQLFDAYKESDQIANLSGQLDKLKASLTIQLAKDLKNAFQTGQLSDRITDMCRVAAALEGNVKENFVKWFIEQQLSEYVIIYADNEEGAWLDKVDDRYKWFVRKLTDFERAGLSNIFPADWHMGRRLTSEFCTVTRDILYRIMTRRRQDLDWKLLGHAIQHTKMFEALLTKRFPEKDGISFEKAIWSVFDTFLDVFINAQEKTLNEFLDTCASKIRSGEEKPSRESSTHAVPFPSSADMFLLLKKVITESSKLSSEPDALIRDVIGVVRVCLRGYATSCLVAFLPSLGSQQSGAANLFSLIREEIAYPRLTPDQQFLVCCILATADWCAETSIQLQEKLSQRIPGVDISQETEAFYSITNQSLQVLVQDVESTCDAALQSISKVNWTAVDCVGDESPFIGSMRAHLRQAVPLIRDMLSDRRKYFAHFCLKLATQLAHKFVGSLFRCRTISTHGAEQLLLDTHSLKTFLLSVPSIDSIINSKPPTAYVTSVNAALTKAEMILKVVMCSLETVDEFVEQYIKLLPASDAAEMQKVLEMKGVKRQEHSAVLNAYRLKIGASGSDPIQQSNSLTSRIGGALPTVGSAASVSEAFNAVVSMAADGLSDQAVTSSIDKLKRFERLVKRQL 80076BB570140CA7 vps51_caeel Vacuolar protein sorting-associated protein 51 homolog vps-51 Protein fat-free homolog B0414.8 protein protein caeel Caenorhabditis elegans MSSVLDVTKPDFDVEAFVVKLLREKSLDGLVKEEEEMVSAVRRLDSDVHQIVYENYNKFLTATNTVRKIQDEFTQLDSEMKSLSRSMSTISTLIGNLDGVLGEKRDDILQLGSSYKVVNSLKHIFDLPHVLRSEFDERNYGEVLRMFKLAEESLSQYKDVPTVQLVLQKSKKIYDMTENQLMDQLRNPASGAELVSEAVDLLLTIGRDEDEVQKVLLTCSEQSLRVDLKELSANHSDVLDLVDKASESFIPNLTLIATTHDRLFEDKREDLITVLKTEMNSLHALVSKVFLSSSDAKDCSIVVRALDRYFRKISTCRYVIPGLDFLPLTIELINAVSKHEIDLSLTRIKEELKNGLNEVRKALINEEKDLSALASKIEQVFVHQVKTALANLLLFTASDVTFANLPPDEFRQSFSFNAHERLLVQAFHRFSELADEYESGAGEIRFVDPRVHLVFAVALQHLSNKSAVYLLNLCREQFSLSPDDGLTDITVVMSEVKTRAQKLVRCYAEKTGLSMGETLIKGCAMLVQPAATPSAVRASVRRLVEEMNTCDSELTLLLGGDSKPKDSRVSRRPITTALDAARDSLWCERIDFHLQIHFNRASIITVIVKVVLKIFIESIRLQTYSKFGVEQVQVDCYYLQRCLAALVSDEVVVNSMVDQALSSALKRCQDPVLVHPSRLAQLCEQPPANRPSSQASSLGY 9BD7F172C2E2884B gosr2_caeel Golgi SNAP receptor complex member 2 homolog memb-1 memb-1 gosr-2.1 B0272.2 protein protein caeel Caenorhabditis elegans MEALYQSTNFLLQKVQHDLGRLEGTQNEQDAQVVVQCIYGDVITLKENCQTLDNYVSREPPARRQAARMRVDQLRADVHRVDMAVSAVHTRMTQRWRAATERDELLRTRYRPNDTALSIGDHELLLNDRLQSSHTHLDDLISQGSAVLENLKSQHLNLRGVGRKMHEIGQALGLSNSTLQVIDRRVREDWILFVIGCIVCCIFMYAFYRFWRG E8C862EF68D358D4 rab6b_caeel Ras-related protein rab-6.2 rab-6.2 T25G12.4 protein protein caeel Caenorhabditis elegans MSDFGNPLKKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNSNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDLSDKRQVTTDEGERKAKELNVMFIETSAKAGYNVKQLFRRIAGALPGIIKDDPVEPPNVVTMDPIRQRQIVTDEGSCWC CFD639343EB5B552 rab6a_caeel Ras-related protein rab-6.1 rab-6.1 F59B2.7 protein protein caeel Caenorhabditis elegans MADFTNNALKKFKLVFLGEQSVGKTSIITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDITNANSFHQTTKWVDDVRNERGCDVIIVLVGNKTDLADKRQVSTEDGEKKARDLNVMFIETSAKAGYNVKQLFRKIATALPGIVQEETPEQPNIVIMNPPKDAEESQGRQCPC A8A0876CF8E456C3 vps-51_vps-53 4 13 unspecified role unspecified role bait bait yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro 12 unspecified role unspecified role prey prey mcherry mcherry mcherry fluorescent protein tag mcherry anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range in vitro In vitro physical association physical association Figure 2 B. vps51-vps_52 5 10 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Figure 2C. vps_52-vps_53 4 12 unspecified role unspecified role prey prey mcherry mcherry mcherry fluorescent protein tag mcherry anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role bait bait yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 2 B. vps_54-vps_53 4 8 unspecified role unspecified role bait bait yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range 12 unspecified role unspecified role prey prey mcherry mcherry mcherry fluorescent protein tag mcherry anti tag western anti tag western blot anti tag western n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Figure 2 B. vps_54-vps_52 4 10 unspecified role unspecified role prey prey mcherry mcherry mcherry fluorescent protein tag mcherry anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role bait bait yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 2 B. vps51-vps_53 5 12 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association Figure 2C. vps51-vps_54 5 8 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association Figure 2C. vps51-vps51 5 13 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association Figure 2C. vps52-vps51 5 10 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 13 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Figure 2C. vps_52-vps_52 5 10 unspecified role unspecified role prey prey yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 10 unspecified role unspecified role bait bait yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast physical association physical association Figure 2C. vps_52-vps_53-1 5 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Figure 2C. vps_52-vps_54 5 10 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Figure 2C. vps_54-vps_53-1 5 8 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association Figure 2C. rab_6_1-vps_52 4 16 unspecified role unspecified role bait bait gfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey mcherry mcherry mcherry fluorescent protein tag mcherry anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 3F. vps_52-rab_6_2 4 15 unspecified role unspecified role prey prey gfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag anti tag western anti tag western blot anti tag western undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait mcherry mcherry mcherry fluorescent protein tag mcherry anti tag western anti tag western blot anti tag western c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Figure 3F. vps51-syn_3 5 6 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association Figure 8A. vps51-syx_16 5 7 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association Figure 8A. vps51-vti_1 5 13 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Figure 8A. vps_52-gosr_2_1 5 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Figure 8A. vps51-gosr_2_1-1 5 14 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association Figure 8A. vps_52-syx_5 5 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Figure 8A. vps_52-syx_16 5 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Figure 8A. vps_52-memb_2 5 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association Figure 8A. vps_54-memb_2 5 8 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association Figure 8A. vps_52-vps51 1 13 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 2A. vps_52-vps_53-2 1 12 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 2A. vps_52-vps_54-1 1 8 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 2A. vps_53-vps_54 1 12 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 2A. vps_52-vps_54-2 1 10 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry exp feature detect experimental feature detection exp feature detect c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 4A. Colocalization observed in C. elegans organism with a vps-51 (tm4275) gene knock-out background. vps_53-vps_54-1 1 8 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 12 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Figure 4A. Colocalization observed in C. elegans organism with a vps-51 (ok853) gene knock-out background. vps_52-vps_54-3 1 10 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 4A. Colocalization observed in C. elegans organism with a vps-53 (ok2864) gene knock-out background. vps_53-vps_54-2 1 12 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 4A. Colocalization observed in C. elegans organism with a vps-54 (ok1463) gene knock-out background. memb_2-vps_53 3 12 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role neutral component neutral component gfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Figure 8B. stx_5-vps_53 3 12 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range 6 unspecified role unspecified role neutral component neutral component gfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Figure 8B. vps_53-vti_1 3 12 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range 9 unspecified role unspecified role neutral component neutral component gfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Figure 8B. syx_16-vps_53 3 12 unspecified role unspecified role neutral component neutral component mcherry mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role neutral component neutral component gfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Figure 8B. vps_54-syx_5 5 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Figure 8A. rab_6_1-vps_52-1 2 10 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 16 unspecified role unspecified role neutral component neutral component gfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag exp feature detect experimental feature detection exp feature detect n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Figure 3E. rab_6_2-vps_52-1 2 15 unspecified role unspecified role neutral component neutral component gfp gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role neutral component neutral component yfp yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Figure 3E.