mpidb The Microbial Protein Interaction Database YjbH-enhanced proteolysis of Spx by ClpXP in Bacillus subtilis is inhibited by the small protein YirB (YuzO). YjbH-enhanced proteolysis of Spx by ClpXP in Bacillus subtilis is inhibited by the small protein YirB (YuzO). J. Bacteriol. (0021-9193) 2011 imex curation Kommineni S., Garg S.K., Chan C.M., Zuber P. 18-Dec-2012: Contacted by IntAct-Help. B. subtilis genomic DNA-activation domain Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kommineni S., Garg S.K., Chan C.M., Zuber P. Accepted 2012-DEC-11 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. B. subtilis genomic DNA-activation domain J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation YjbH-enhanced proteolysis of Spx by ClpXP in Bacillus subtilis is inhibited by the small protein YirB (YuzO). YjbH-enhanced proteolysis of Spx by ClpXP in Bacillus subtilis is inhibited by the small protein YirB (YuzO). J. Bacteriol. (0021-9193) 2011 imex curation Kommineni S., Garg S.K., Chan C.M., Zuber P. 18-Dec-2012: Contacted by IntAct-Help. B. subtilis genomic DNA-activation domain Only protein-protein interactions bacsu Bacillus subtilis pull down pull down western blot western blot Immuno blot Immuno blot Kommineni S., Garg S.K., Chan C.M., Zuber P. Accepted 2012-DEC-11 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. B. subtilis genomic DNA-activation domain J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation YjbH-enhanced proteolysis of Spx by ClpXP in Bacillus subtilis is inhibited by the small protein YirB (YuzO). YjbH-enhanced proteolysis of Spx by ClpXP in Bacillus subtilis is inhibited by the small protein YirB (YuzO). J. Bacteriol. (0021-9193) 2011 imex curation Kommineni S., Garg S.K., Chan C.M., Zuber P. 18-Dec-2012: Contacted by IntAct-Help. B. subtilis genomic DNA-activation domain Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kommineni S., Garg S.K., Chan C.M., Zuber P. Accepted 2012-DEC-11 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. B. subtilis genomic DNA-activation domain J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation mana3_bacsu Putative mannose-6-phosphate isomerase YvyI yvyI pmi Phosphohexomutase Phosphomannose isomerase BSU35790 protein protein bacsu Bacillus subtilis MTQSPIFLTPVFKEKIWGGTALRDRFGYSIPSESTGECWAISAHPKGPSTVANGPYKGKTLIELWEEHREVFGGVEGDRFPLLTKLLDVKEDTSIKVHPDDYYAGENEEGELGKTECWYIIDCKENAEIIYGHTARSKTELVTMINSGDWEGLLRRIKIKPGDFYYVPSGTLHALCKGALVLETQQNSDATYRVYDYDRLDSNGSPRELHFAKAVNAATVPHVDGYIDESTESRKGITIKTFVQGEYFSVYKWDINGEAEMAQDESFLICSVIEGSGLLKYEDKTCPLKKGDHFILPAQMPDFTIKGTCTLIVSHI 21E6FF26E7CF922F gabr_bacsu HTH-type transcriptional regulatory protein GabR gabR ycnF BSU03890 protein protein bacsu Bacillus subtilis MDITITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAEEHPPFALPDDLKEIHIDQSDWISFSHMSSDTDHFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDRFQNVIYMGTFSKSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEFDTRRTEQDILSHAAGLQLEIFGMSRFNLKENKRQTGRPALIIGFARLKEEDIQEGVQRLFKAVYGHKKIPVTGD B8138FD28A276A4E spxh_bacsu ClpXP adapter protein SpxH spxH yjbH BSU11550 protein protein bacsu Bacillus subtilis MTNYQHELYFAHCHGHPKKPLEIYMFVDPLCPECWSLEPVIKKLKIRYGRFFTLRIIASASLTALNKKRKKHLLAEAWEKIASRSGMSCDGNVWFEQDQPLSSPYMAALAFKAAELQGRKAGMQFLRNMQESLFVSKKNITDENVLLEIAENTSLDLEEFKKDLHSQSAVKALQCDMKIAAEMDVSVNPTLTFFNTQHEDEGLKVPGSYSYDVYEEILFEMLGDEPKPSETPPLECFIEYFRFVASKEIALVYDLSLEEVEKEMKKLAFAKKVAKVEAKHGMFWKSLSTYSDEYQSCEK A2F4BD24A1977339 ctsr_bacsu Transcriptional regulator CtsR yacG Class three stress gene repressor BSU00830 ctsR protein protein bacsu Bacillus subtilis MGHNISDIIEQYLKRVLDQNGKEILEIKRSEIADKFQCVPSQINYVINTRFTSERGYIVESKRGGGGYIRIIKIKMNNEVVLINNIISQINTHLSQAASDDIILRLLEDKVISEREAKMMVSVMDRSVLHIDLPERDELRARMMKAMLTSLKLK 11A2B4EC15809CF6 yqah_bacsu Uncharacterized protein YqaH BSU26310 yqaH protein protein bacsu Bacillus subtilis MNTNHFLKADVPIAKRKIESAEELSIMLSEALRDGDYEEAISLAGSIKVLTEDISRLANKGRLYETALKMQQQGINLTVVSRCIG 538587FE4F117931 yuxj_bacsu Uncharacterized MFS-type transporter YuxJ yuxJ yugC ORF1 BSU31480 protein protein bacsu Bacillus subtilis MWLANFFVSASTTMIVPFLSLYIETLSSFSNGFVQRWSGYVFGITFLMAFLVSPFWGRFGDKRGYKKILMATGTGIALSIFFMGFVTSVYQLFFLRMAMGLVTGFIPTSLAMISAQTPKSSAGKTLGTLQMGQVSGSLFGPLLGGMLADRFGFTYTFFITSFVIFSSVLLVLFGVKEKHLAEKTAKRTSYSRKEVLSYIFHHPALWVMMLLTMLIQTGNFSIQPLLALYVNELHGPVNLAFFSGMAFSATGLGSLLLARKWGDLGDRYGHRRILIGLLLAASFFFIPQALASSLSVLLVFRFLFGMAMGGLLPCITAAIRVQAPGSIQGEVLGYNVSFRFLGNVLGPLLGGIISSHFTISATFYVTAFLFFAGACMLWIMQKLRKDSYAKAS 1029BAE0EE8AA2FE yosl_bacsu SPbeta prophage-derived uncharacterized protein YosL yosL BSU20080 protein protein bacsu Bacillus subtilis MGAARRIDPTQPYVKKKNIINFTVATENTHIHLADGQSFPVLKGEIIATDQQGNQFVELEKNLDDYVPVKKSSLYESMAQGYMEMGDINREISEAFNYAENEAETVTTKLITGAYND 234924231E560BBD spx_bacsu Global transcriptional regulator Spx spx Redox-responsive transcription factor Spx Suppressor of clpP and clpX spxA yjbD BSU11500 protein protein bacsu Bacillus subtilis MVTLYTSPSCTSCRKARAWLEEHEIPFVERNIFSEPLSIDEIKQILRMTEDGTDEIISTRSKVFQKLNVNVESMPLQDLYRLINEHPGLLRRPIIIDEKRLQVGYNEDEIRRFLPRKVRSFQLREAQRLAN E296B3B7A90397D7 fliz_bacsu Flagellar biosynthetic protein FliZ cheA BSU16340 fliZ protein protein bacsu Bacillus subtilis MKKSQYFIVFICFFVLFSVHPIAAAAADSDNSTVNEWFQKKDEKTADQSEQKKEKTTKTADETEGAAAPSVSAFDFVKMIFALLFVIVLIYGLVKLMNKRNRLLKPFQYVENIGGTSVGQNRSIQLIKVGKSVLVVGVGETIQLLKEIEDEKEIEVILSQHEEAMSSKIEWQKFVKPLKSSEHQPQQKLPSFSKALKEQLEELKQNRSEGKKKGPRHHE 6FE82AF8E1DAEE8E bshc_bacsu Putative cysteine ligase BshC bshC yllA BSU15120 protein protein bacsu Bacillus subtilis MQLTELSIKNQNVFVQHYIDGKEEMSSFFDYSIHHKDMWRERLEDLSSRFFAREELAAYLTSYHNKFGSSAMQSAIEKLKDPSSAAVVGGQQAGLLTGPLYTIHKIISIIVLAKQQEKELQVPVIPIFWVAGEDHDLDEINFVHTSEENGPVKKKLPQSYWKKSSAASTSLDQEKCAAWIDDVFAAFEETDHTNTLLDNVKRCLRESVTFTDFFELLIADLFQEEGLVLLNSGDPGIKKLETAMFQKILRENDELARAVSDQQAFMRQAGYKPIIESGKEQANLFYEYEDERFLIEKDNGRFVIKELDLGWTRDELHTHMEEHPERFSNNVVTRPLMQEFLIPTLAFIAGPGEINYWGELKQAFAVMGFKMPPVMPRLNITILERHIEKKLAERNISLQDAIERGTENQRETYFERQIPEEFTAVMDQAKSQIEAIHKTVRQEALKVDQSLEPLLLKNAAFIQDQLQFLERTVMKRIEEKEGYVLKDYERIQNSIKPLLAPQERIWNIMYYLNRYGPKFFTTFKNLPFSFQNQHQVVKL 86DBC2919B92E690 spxo_bacsu Anti-adapter protein SpxO spxO yirB yuzO BSU33029 protein protein bacsu Bacillus subtilis MRELDEMISRLRNRGIKVEKVKYPKQTLSEKKWVHQCKQPLKTNYRDFNGYSFT 5A8CF96B635300E5 yjbh-yuzo 1 14 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait region O31606-1-24 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain physical association physical association figure 1 yuzo-yjbh 2 6 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait o32302-- O32302-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 3C spxa-yjbh-2 2 11 unspecified role unspecified role bait bait o31602-- O31602-- strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 4 YjbH did not coelute with Spx-Strep when YirB-His was included in the reaction mixture yjbh-yuzo-1 3 14 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Supp. Table 1 yjbh-yqah 3 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Supp. Table 1 yjbh-fliz 3 12 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Supp. Table 1 yjbh-ctsr 3 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Supp. Table 1 yjbh-yvyi 3 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Supp. Table 1 yjbh-yosl 3 10 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Supp. Table 1 yjbh-gabr 3 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Supp. Table 1 yjbh-ylla 3 13 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Supp. Table 1 yjbh-yuxj 3 9 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Supp. Table 1