UniProt UniProt http://www.uniprot.org Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families. Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families. PLoS ONE 2011 mimix curation Hudson J.J., Bednarova K., Kozakova L., Liao C., Guerineau M., Colnaghi R., Vidot S., Marek J., Bathula S.R., Lehmann A.R., Palecek J. CoIP interactions in tabular form (Fig. 9) are omitted if respect. gel blots are not included in the publication jpalecek@sci.muni.cz 19-Jun-2012: Contacted by JYOTI. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Hudson J.J., Bednarova K., Kozakova L., Liao C., Guerineau M., Colnaghi R., Vidot S., Marek J., Bathula S.R., Lehmann A.R., Palecek J. CoIP interactions in tabular form (Fig. 9) are omitted if respect. gel blots are not included in the publication jpalecek@sci.muni.cz Accepted 2012-FEB-15 by PPORRAS 19-Jun-2012: Contacted by JYOTI. PLoS ONE 2011 mimix curation Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families. Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families. PLoS ONE 2011 mimix curation Hudson J.J., Bednarova K., Kozakova L., Liao C., Guerineau M., Colnaghi R., Vidot S., Marek J., Bathula S.R., Lehmann A.R., Palecek J. CoIP interactions in tabular form (Fig. 9) are omitted if respect. gel blots are not included in the publication jpalecek@sci.muni.cz 19-Jun-2012: Contacted by JYOTI. mouse-testis Mus musculus testis testis anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hudson J.J., Bednarova K., Kozakova L., Liao C., Guerineau M., Colnaghi R., Vidot S., Marek J., Bathula S.R., Lehmann A.R., Palecek J. CoIP interactions in tabular form (Fig. 9) are omitted if respect. gel blots are not included in the publication jpalecek@sci.muni.cz Accepted 2012-FEB-15 by PPORRAS 19-Jun-2012: Contacted by JYOTI. PLoS ONE 2011 mimix curation Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families. Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families. PLoS ONE 2011 mimix curation Hudson J.J., Bednarova K., Kozakova L., Liao C., Guerineau M., Colnaghi R., Vidot S., Marek J., Bathula S.R., Lehmann A.R., Palecek J. CoIP interactions in tabular form (Fig. 9) are omitted if respect. gel blots are not included in the publication jpalecek@sci.muni.cz 19-Jun-2012: Contacted by JYOTI. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 3 hybrid three hybrid 3-hybrid tri hybrid tri-hybrid assay 3 hybrid predetermined predetermined participant predetermined Hudson J.J., Bednarova K., Kozakova L., Liao C., Guerineau M., Colnaghi R., Vidot S., Marek J., Bathula S.R., Lehmann A.R., Palecek J. CoIP interactions in tabular form (Fig. 9) are omitted if respect. gel blots are not included in the publication jpalecek@sci.muni.cz Accepted 2012-FEB-15 by PPORRAS 19-Jun-2012: Contacted by JYOTI. PLoS ONE 2011 mimix curation Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families. Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families. PLoS ONE 2011 mimix curation Hudson J.J., Bednarova K., Kozakova L., Liao C., Guerineau M., Colnaghi R., Vidot S., Marek J., Bathula S.R., Lehmann A.R., Palecek J. CoIP interactions in tabular form (Fig. 9) are omitted if respect. gel blots are not included in the publication jpalecek@sci.muni.cz 19-Jun-2012: Contacted by JYOTI. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Hudson J.J., Bednarova K., Kozakova L., Liao C., Guerineau M., Colnaghi R., Vidot S., Marek J., Bathula S.R., Lehmann A.R., Palecek J. CoIP interactions in tabular form (Fig. 9) are omitted if respect. gel blots are not included in the publication jpalecek@sci.muni.cz Accepted 2012-FEB-15 by PPORRAS PLoS ONE 2011 mimix curation Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families. Interactions between the Nse3 and Nse4 components of the SMC5-6 complex identify evolutionarily conserved interactions between MAGE and EID Families. PLoS ONE 2011 mimix curation Hudson J.J., Bednarova K., Kozakova L., Liao C., Guerineau M., Colnaghi R., Vidot S., Marek J., Bathula S.R., Lehmann A.R., Palecek J. CoIP interactions in tabular form (Fig. 9) are omitted if respect. gel blots are not included in the publication jpalecek@sci.muni.cz 19-Jun-2012: Contacted by JYOTI. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Hudson J.J., Bednarova K., Kozakova L., Liao C., Guerineau M., Colnaghi R., Vidot S., Marek J., Bathula S.R., Lehmann A.R., Palecek J. CoIP interactions in tabular form (Fig. 9) are omitted if respect. gel blots are not included in the publication jpalecek@sci.muni.cz Accepted 2012-FEB-15 by PPORRAS 19-Jun-2012: Contacted by JYOTI. PLoS ONE 2011 mimix curation nse4_schpo Non-structural maintenance of chromosome element 4 nse4 rad62 SPBC20F10.04c DNA repair protein rad62 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSSIDKRDLRKRYRNLINKVQESRLELVDEENNNLYETITTANDLFSSVDAPTEATLDALLLTKTVDLASIKARQLHIGRPKFNIELFTKNIKQFLNYPTSHSNVTRIQEIDTAWSRLGKLASNCEKQPASLNLMVGPLSFRKKERNIQRRERLQKAPNVLTQPTMLNERNITTQENNTTKNVLHISRLLQAHQPVNFLKFITNPQSYPQTVENLFYVSFLFKEGKAALVENESGILMLETRIPPTDDQVVAGEIRNIQLVLDMTMDLYENIIKEYNIKESIIPTRAPVETSTNSNTWYG BE3A764555494F89 nse2_mouse E3 SUMO-protein ligase NSE2 Nsmce2 Mms21 MMS21 homolog Non-structural maintenance of chromosomes element 2 homolog E3 SUMO-protein transferase NSE2 protein protein mouse Mus musculus Mouse MPGRSSTSSGSTRYISFSGIESALSSLKNFQSCISSGMDTVSSVALDLVETQTEVSSEYSMDKAMVEFAKMDRELSHYVKAVQSTINHVKEERPEKVPDLKLLVEKKFLALQDKNSDADFKENEKFVQFKQQLRELKKQYGIHADRENDLTEGVDEDMIVTQSQTNFICPITQLEMKKPVKNKMCGHTYEEEAIVRMIESKHKRKKKACCPKIGCSHTDMRMSDLIPDEALRRAIESHNKKKKRHSE 605E11F7F8785980 eid3_mouse EP300-interacting inhibitor of differentiation 3 Eid3 EID-1-like inhibitor of differentiation 3 Non-structural maintenance of chromosomes element 4 homolog B protein protein mouse Mus musculus Mouse MSKEKCSLTGGKEKRGELVRSLAWQHLVKQEEEEAVKKEEKEEGEDEEEEGSDSSSDDPNPEPPCMHPDLLELVVDREKCRKIRRQYRQLIYTVQQNREDIVNTASDTLSEALEEANVLFDGVSRTREAALDAQFLVLASDLGKEKAKQLNTDMNFFNPIAFCDLLLLFVGFNWVEEECKEFSDCDDSIVLSFWGMLHEEATSWMLQAETFHFIFGSFKAERSARKPRLGCHKRACKMEGSGDMPTKLRRLDVHANQETTEKEVERILGLLQTYFQKYPDTPVSYFEFVIDPNSFSRTVENIFYVSFIIRDGFARIRLDQDRLPILEPTNVSQVDDESDSYSYCRKQGVISLSLQDWKNIVSTFEISEAMIKNSY 9637798934ADDF24 eid1_human EP300-interacting inhibitor of differentiation 1 EID1 C15orf3 CRI1 RBP21 PNAS-22 PTD014 E1A-like inhibitor of differentiation 1 CREBBP/EP300 inhibitory protein 1 21 kDa pRb-associated protein protein protein human Homo sapiens Human MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE A2815FA78ED0736D eid3_human EP300-interacting inhibitor of differentiation 3 EID-1-like inhibitor of differentiation 3 E1A-like inhibitor of differentiation 3 EID3 Non-structural maintenance of chromosomes element 4 homolog B protein protein human Homo sapiens Human MKMDVSVRAAGCSDDLSSGEADVDPKLLELTADEEKCRSIRRQYRQLMYCVRQNREDIVSSANNSLTEALEEANVLFDGVSRTREAALDARFLVMASDLGKEKAKQLNSDMNFFNQLAFCDFLFLFVGLNWMEGDPDKLSDCDDSIALSFWKAIEKEATSWMVKAETFHFVFGSFKLERSAPKPRLEHQKKVRKMEENGNMPTKLQKLDLSSYPEATEKNVERILGLLQTYFRKYPDTPVSYFEFVIDPNSFSRTVENIFYVSFIVRDGFARIRLDEDRLPILEPMNVNQMGEGNDSSCHGRKQGVISLTLQEWKNIVAAFEISEAMITYSSY 3B35D08977C47C5A smc6_mouse Structural maintenance of chromosomes protein 6 Kiaa4103 Smc6l1 Smc6 protein protein mouse Mus musculus Mouse MAKRKEENFCSPENAKRPRQEELEDFDKDGDEDECTISFTNGTSTLTAAEVGIIESIQLRNFMCHSMLGPFKFGSNVNFVVGNNGSGKSAVLTALIVGLGGKAVATNRGSSLKGFVKAGQNSADISITLRNRGDDAFRANVYGDSIVVQQHISVDGSRSYKLKSEKGTVVSTRKEELIAILDHFNIQVDNPVSVLTQEMSKQFLQSKNEGDKYKFFMKATQLEQMKEDYSYIMETKERTKEQINQGEERLTELKRQCLEKEERFQNIAGLSTMKTNLEYLKHEMAWAVVNEIEKQLNAIRDNIKIGEERAAKLDRKMEEQQVRLNDAEKKYKDIQDKLEKISEETNARAPECMALKTDVIARTRAFNDAEVLYNRSLNEYKALKKDGEQLCKRIEELKKSTDQSLEPERLERQKRICWLKEKVKALQDQEHTVNQEAEQFEQAIEKDKQEHGRVRKEDIEVRHALNYNQRQLKELKDSKTDRLKRFGPHVPALLEAIDDAYRRRQFTHKPIGPLGACIHLRDPELALAIESCLKGLLQAYCCHNHADERVLQSLMKKFYPPGTSRPQIIVSEFRDEVYDVRLRAAYHPEFPTVLTALEIDNAVVANSLIDMRSIETVLLIKNNSVARAVMQSQKPPKNCREAFTADGDQVFAGRYYSSESTRPKFLSRDVDSEISDLETEIENKKGHIITLQQRLSALEKDIKRNEELLKRCQLHYKEIKMKIRKNISEIRELENIEEHQSVDIATLEDEAEENKIKMQMVEKNMEQQKENMENLKSLKIEAENKYDTIKLKINQLSELADPLKDELNLADSEVDSQKRGKQHYEDKQKEHLDTLNKKRRELDMKEKELQEKMSQARQICPERIEVKKSASILDKEINRLRQKIQAEHASHGDREEIMKQYQEARETYLDLDNKVRTLRRFIKLLEEIMTHRYKTYQQFRRCLTLRCKLYFDNLLSQRAYCGKMNFDHKNETLSITVQPGEGNKASFNDMRALSGGERSFSTVCFILSLWSIAESPFRCLDEFDVYMDMVNRRIAMDMILKMADSQRFRQFILLTPQSMSSLPSSKLIRILRMSDPERGQTTLPFRPVTQEEDDSAS 7329C25A85102DE5 eid2_human EP300-interacting inhibitor of differentiation 2 EID2 CRI2 CREBBP/EP300 inhibitor 2 EID-1-like inhibitor of differentiation 2 protein protein human Homo sapiens Human MSKLPADSSVPQTGAANGDRDVPQAEVGRGRREPAPAQPEEAGEGAMAAARGGPVPAAREGRMAAARAAPAAAARGAPVAAAALARAAAAGRESPAAAAAREARMAEVARLLGEPVDEEGPEGRPRSRHGNGGLAALPYLRLRHPLSVLGINYQQFLRHYLENYPIAPGRIQELEERRRRFVEACRAREAAFDAEYQRNPHRVDLDILTFTIALTASEVINPLIEELGCDKFINRE A69BD5AA098EDC95 nse1_schpo Non-structural maintenance of chromosomes element 1 nse1 SPCC550.05 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEKERQDGLSDKHKFILQYIMCRTAGVDNEQVRELVQEQYGETATVEDVINELNNSLHNFDFKIKRVQDQLDGRLTLHFQNLSGDPVSQMATPYPPVQIELMRKIIEWIMKCDDYQYSLTTLQIQKLSRKEMGLAPSVIESHLHTFERDGWLRQREGIWTFTNHALAELDAYLHNEYESNLYECNACREIVIAGYVCDCGYCLHVYCCKHLAHVNCINCNTPWANATVIGRW 9255E146B354CEA8 magd4_human Melanoma-associated antigen D4 MAGED4B MAGED4A MAGE-D4 antigen MAGE-E1 antigen MAGED4 KIAA1859 MAGEE1 protein protein human Homo sapiens Human MAEGSFSVQSESYSVEDMDEGSDEVGEEEMVEGNDYEEFGAFGGYGTLTSFDIHILRAFGSLGPGLRILSNEPWELENPVLAQTLVEALQLDPETLANETAARAANVARAAASNRAARAAAAAARTAFSQVVASHRVATPQVSGEDTQPTTYAAEAQGPTPEPPLASPQTSQMLVTSKMAAPEAPATSAQSQTGSPAQEAATEGPSSACAFSQAPCAREVDANRPSTAFLGQNDVFDFTQPAGVSGMAFPRPKRPAPAQEAATEGPSAASGVPQTGPGREVAATRPKTTKSGKALAKTRWVEPQNVVAAAAAKAKMATSIPEPEGAAAATAQHSAEPWARMGGKRTKKSKHLDDEYESSEEERETPAVPPTWRASQPSLTVRAQLAPRPPMAPRSQIPSRHVLCLPPRNVTLLQERANKLVKYLMIKDYKKIPIKRADMLKDVIREYDEHFPEIIERATYTLEKKFGIHLKEIDKEEHLYILVCTRDSSARLLGKTKDTPRLSLLLVILGVIFMNGNRASEAVLWEALRKMGLRPGVRHPFLGDLRKLITDDFVKQKYLEYKKIPNSNPPEYEFLWGLRARHETSKMRVLRFIAQNQNRDPREWKAHFLEAVDDAFKTMDVDMAEEHARAQMRAQMNIGDEALIGRWSWDDIQVELLTWDEDGDFGDAWARIPFAFWARYHQYILNSNRANRRATWRAGVSSGTNGGASTSVLDGPSTSSTIRTRNAARAGASFFSWIQHR 56B073324C12A8EC maga1_human Melanoma-associated antigen 1 MAGE-1 antigen Antigen MZ2-E Cancer/testis antigen 1.1 MAGEA1 MAGE1 MAGE1A protein protein human Homo sapiens Human MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINFTRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVLEYVIKVSARVRFFFPSLREAALREEEEGV 544EEB1F9F4E9D33 544EEB1F9F4E9D33 necd_human Necdin NDN protein protein human Homo sapiens Human MSEQSKDLSDPNFAAEAPNSEVHSSPGVSEGVPPSATLAEPQSPPLGPTAAPQAAPPPQAPNDEGDPKALQQAAEEGRAHQAPSAAQPGPAPPAPAQLVQKAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSILRRTSLILARVFGLHLRLTSLHTMEFALVKALEPEELDRVALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED 5068FE121308BFAF magf1_human Melanoma-associated antigen F1 MAGEF1 MAGE-F1 antigen protein protein human Homo sapiens Human MLQTPESRGLPVPQAEGEKDGGHDGETRAPTASQERPKEELGAGREEGAAEPALTRKGARALAAKALARRRAYRRLNRTVAELVQFLLVKDKKKSPITRSEMVKYVIGDLKILFPDIIARAAEHLRYVFGFELKQFDRKHHTYILINKLKPLEEEEEEDLGGDGPRLGLLMMILGLIYMRGNSAREAQVWEMLRRLGVQPSKYHFLFGYPKRLIMEDFVQQRYLSYRRVPHTNPPEYEFSWGPRSNLEISKMEVLGFVAKLHKKEPQHWPVQYREALADEADRARAKARAEASMRARASARAGIHLW 8CB673B3FF7921EE nse3_human Non-structural maintenance of chromosomes element 3 homolog HCA4 Hepatocellular carcinoma-associated protein 4 MAGE-G1 antigen MAGEG1 Melanoma-associated antigen G1 NDNL2 Necdin-like protein 2 NSMCE3 protein protein human Homo sapiens Human MLQKPRNRGRSGGQAERDRDWSHSGNPGASRAGEDARVLRDGFAEEAPSTSRGPGGSQGSQGPSPQGARRAQAAPAVGPRSQKQLELKVSELVQFLLIKDQKKIPIKRADILKHVIGDYKDIFPDLFKRAAERLQYVFGYKLVELEPKSNTYILINTLEPVEEDAEMRGDQGTPTTGLLMIVLGLIFMKGNTIKETEAWDFLRRLGVYPTKKHLIFGDPKKLITEDFVRQRYLEYRRIPHTDPVDYEFQWGPRTNLETSKMKVLKFVAKVHNQDPKDWPAQYCEALADEENRARPQPSGPAPSS C00E2FB2D2CCED7B nse1_human Non-structural maintenance of chromosomes element 1 homolog NSMCE1 HSPC333 HSPC337 protein protein human Homo sapiens Human MQGSTRRMGVMTDVHRRFLQLLMTHGVLEEWDVKRLQTHCYKVHDRNATVDKLEDFINNINSVLESLYIEIKRGVTEDDGRPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNILNLVDQLKGKKMRKKEAEQVLQKFVQNKWLIEKEGEFTLHGRAILEMEQYIRETYPDAVKICNICHSLLIQGQSCETCGIRMHLPCVAKYFQSNAEPRCPHCNDYWPHEIPKVFDPEKERESGVLKSNKKSLRSRQH 58A3C2AF70FC8F39 nse3_schpo Non-structural maintenance of chromosome element 3 SPCC645.04 nse3 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSQLSFTGKSSSKGRSRLTQEVRPTASQIIADEEASDLDEYEEDLEGSGNEDDFGPSMSRSSRGRKRRKGDPLELQSQFEERNETDAINFQLLVRNVVRYAICSQTSHNTITRKDIVQKAFPEGTSRNLFQSVFEEADRQLQLSFGFRLVAVTQSNRKKDMAVSQLRRPATSNANSSNLHRYWVLRSTLPMELQKDSRLIVDSVLDTAYYGFLMTVIAFIAVSHCSVGHSELQSFLQELLTEEETTPLHLDITRSLSLLVRQGYLDRVKDDTHNQFVYYIGSRAVTEISIEGLKSFVTEFFPDSDIDMDALLTEYRQEYQNQSSSSAA 80E2E470076B11E0 eid2b_human EP300-interacting inhibitor of differentiation 2B EID3 EID-2-like inhibitor of differentiation 3 EID2B protein protein human Homo sapiens Human MAEPTGLLEMSELPGDSSVPQVGTASGVSDVLRGAVGGGVRVQEAREGPVAEAARSMARMPGPVPGPIPSSVPGLASAPDPHQQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRLFVEGCKAREAAFDADPPQMDFAAVAFTVALTASEALSPLAD F378CD438AB12661 nse4a_human Non-structural maintenance of chromosomes element 4 homolog A NSMCE4A C10orf86 PP4762 protein protein human Homo sapiens Human MSGDSSGRGPEGRGRGRDPHRDRTRSRSRSRSPLSPRSRRGSARERREAPERPSLEDTEPSDSGDEMMDPASLEAEADQGLCRQIRHQYRALINSVQQNREDILNAGDKLTEVLEEANTLFNEVSRAREAVLDAHFLVLASDLGKEKAKQLRSDLSSFDMLRYVETLLTHMGVNPLEAEELIRDEDSPDFEFIVYDSWKITGRTAENTFNKTHTFHFLLGSIYGECPVPKPRVDRPRKVPVIQEERAMPAQLRRMEESHQEATEKEVERILGLLQTYFREDPDTPMSFFDFVVDPHSFPRTVENIFHVSFIIRDGFARIRLDQDRLPVIEPVSINEENEGFEHNTQVRNQGIIALSYRDWEEIVKTFEISEPVITPSQRQQKPSA 8BB8C54C8A6D0A1E nse3-nse1-4 4 20 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey physical association physical association 1A nse3-nse4-5 4 6 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association 1B and C nse1-nse4 4 13 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 1D and E nse3-nse1-5 1 13 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Table 1 nse3-nse4-6 1 20 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Table 1 nse3-nse4-7 3 13 unspecified role unspecified role ancillary ancillary 20 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 4A ndnl2-eid3 1 10 unspecified role unspecified role prey prey 18 unspecified role unspecified role bait bait physical association physical association 5A ndnl2-nsmce1-2 1 18 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey physical association physical association 5A ndnl2-eid3-1 5 18 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 5B eid3-nsmce2 2 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association 7A ndnl2-eid3-2 5 18 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey association association 7B left panel magea1-eid3 5 10 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait association association 7B right panel eid3-magea1 5 10 unspecified role unspecified role bait bait 19 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey association association 7B middle panel magea1-nsmce4a 5 22 unspecified role unspecified role prey prey 15 unspecified role unspecified role bait bait physical association physical association 7C magea1-eid3-1 5 15 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 7C maged4b-eid3 5 22 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association 7D maged4b-eid3-1 5 10 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association 7D ndnl2-eid3-3 5 18 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey physical association physical association 7F ndnl2-eid3-4 5 18 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 7F ndn-eid3 5 16 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey physical association physical association 7G ndn-eid3-1 5 16 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey physical association physical association 7G magea1-eid1 5 15 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 8B magea1-eid1-1 5 15 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association 8B magea1-eid1-2 5 15 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey physical association physical association 8B magef1-eid1-1 5 17 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 8D magef1-eid2 5 17 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey physical association physical association 8D magef1-eid2b 5 17 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey physical association physical association 8D ndn-eid1-5 5 16 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 8F ndn-eid2-1 5 12 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait physical association physical association 8F ndn-eid2b 5 16 unspecified role unspecified role bait bait 21 unspecified role unspecified role prey prey physical association physical association 8F