mpidb The Microbial Protein Interaction Database Effects of metal on the biochemical properties of Helicobacter pylori HypB, a maturation factor of [NiFe]-hydrogenase and urease. Effects of metal on the biochemical properties of Helicobacter pylori HypB, a maturation factor of [NiFe]-hydrogenase and urease. J. Bacteriol. (0021-9193) 2011 imex curation Sydor A.M., Liu J., Zamble D.B. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Sydor A.M., Liu J., Zamble D.B. Accepted 2012-DEC-11 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation hypb_helpy Hydrogenase/urease maturation factor HypB hypB HP_0900 Hydrogenase/urease nickel incorporation protein HypB protein protein helpy Helicobacter pylori Campylobacter pylori MSEQRQESLQNNPNLSKKDVKIVEKILSKNDIKAAEMKERYLKEGLYVLNFMSSPGSGKTTMLENLADFKDFKFCVVEGDLQTNRDADRLRKKGVSAHQITTGEACHLEASMIEGAFDLLKDEGALEKSDFLIIENVGNLVCPSSYNLGAAMNIVLLSVPEGDDKVLKYPTMFMCADAVIISKADMVEVFNFRVSQVKEDMQKLKPEAPIFLMSSKDPKSLEDFKNFLLEKKRENYQSTHSF 7C505390FB5C0142 hypb-3 1 2 unspecified role unspecified role neutral component neutral component O25560:p.Cys106_His107delinsAlaAla mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain CH AA Thu Jul 07 12:07:04 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was cys106_his107ala Fri Jul 22 10:59:17 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys106ala,his107ala' Wed May 02 16:48:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys_his106-107ala_ala' Tue Jun 30 17:41:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys106_His107delinsAlaAla' physical association physical association figure 4 Metal-dependent dimerization observed in the presence of Ni(II) but not Zn(II).