IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Arabidopsis type I metacaspases control cell death. Arabidopsis type I metacaspases control cell death. Science (0036-8075) 2010 imex curation Coll N.S., Vercammen D., Smidler A., Clover C., Van Breusegem F., Dangl J.L., Epple P. pepple@email.unc.edu; dangl@email.unc.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Coll N.S., Vercammen D., Smidler A., Clover C., Van Breusegem F., Dangl J.L., Epple P. pepple@email.unc.edu; dangl@email.unc.edu Accepted 2012-APR-05 by MGT 19-Jun-2012: Contacted by JYOTI. Science (0036-8075) 2010 Only protein-protein interactions imex curation Arabidopsis type I metacaspases control cell death. Arabidopsis type I metacaspases control cell death. Science (0036-8075) 2010 imex curation Coll N.S., Vercammen D., Smidler A., Clover C., Van Breusegem F., Dangl J.L., Epple P. pepple@email.unc.edu; dangl@email.unc.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Coll N.S., Vercammen D., Smidler A., Clover C., Van Breusegem F., Dangl J.L., Epple P. pepple@email.unc.edu; dangl@email.unc.edu Accepted 2012-APR-05 by MGT Science (0036-8075) 2010 Only protein-protein interactions imex curation Arabidopsis type I metacaspases control cell death. Arabidopsis type I metacaspases control cell death. Science (0036-8075) 2010 imex curation Coll N.S., Vercammen D., Smidler A., Clover C., Van Breusegem F., Dangl J.L., Epple P. pepple@email.unc.edu; dangl@email.unc.edu 19-Jun-2012: Contacted by JYOTI. Only protein-protein interactions nicbe Nicotiana benthamiana anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Coll N.S., Vercammen D., Smidler A., Clover C., Van Breusegem F., Dangl J.L., Epple P. pepple@email.unc.edu; dangl@email.unc.edu Accepted 2012-APR-05 by MGT 19-Jun-2012: Contacted by JYOTI. Science (0036-8075) 2010 Only protein-protein interactions imex curation mca1_arath Metacaspase-1 AMC1 LOL3 MCP1B Metacaspase 1b Protein LSD ONE LIKE 3 T7I23.17 At1g02170 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MYPPPPSSIYAPPMLVNCSGCRTPLQLPSGARSIRCALCQAVTHIADPRTAPPPQPSSAPSPPPQIHAPPGQLPHPHGRKRAVICGISYRFSRHELKGCINDAKCMRHLLINKFKFSPDSILMLTEEETDPYRIPTKQNMRMALYWLVQGCTAGDSLVFHYSGHGSRQRNYNGDEVDGYDETLCPLDFETQGMIVDDEINATIVRPLPHGVKLHSIIDACHSGTVLDLPFLCRMNRAGQYVWEDHRPRSGLWKGTAGGEAISISGCDDDQTSADTSALSKITSTGAMTFCFIQAIERSAQGTTYGSLLNSMRTTIRNTGNDGGGSGGVVTTVLSMLLTGGSAIGGLRQEPQLTACQTFDVYAKPFTL 98DCC44A986E0C5A mca2_arath Metacaspase-2 AMC2 MCP1C Metacaspase 1c F13M23.250 At4g25110 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MLLLVDCSSCRTPLHLPPGATRIRCAICHAFTLIAPEPRLQSHASASPFPFPNSSPAPSTFIYPPPTPSPYTHAPHAPSPFNHAPPDSYPFTHAPPASSPFNHAPPGPPPPVHGQKRAVIVGVSYKNTKDELKGCINDANCMKFMLMKRFQFPESCILMLTEEEADPMRWPTKNNITMAMHWLVLSCKPGDSLVFHFSGHGNNQMDDNGDEVDGFDETLLPVDHRTSGVIVDDEINATIVRPLPYGVKLHAIVDACHSGTVMDLPYLCRMDRLGNYEWEDHRPKTGMWKGTSGGEVFSFTGCDDDQTSADTPQLSGSAWTGAMTYAFIQAIERGHGMTYGSLLNAMRSTVHEIFDKNKGRELVEVGGADFLSTLLGLLILGASPPDEEEEVNQAPQKTQEPQLSANEAFAVYEKPFSL 3195739BCB646B1D lsd1_arath Protein LSD1 LSD1 CHS4 Protein CHILLING SENSITIVE 4 Protein LESION SIMULATING DISEASE 1 Putative zinc finger LSD1 F9F13.30 At4g20380 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKVADMQDQLVCHGCRNLLMYPRGASNVRCALCNTINMVPPPPPPHDMAHIICGGCRTMLMYTRGASSVRCSCCQTTNLVPAHSNQVAHAPSSQVAQINCGHCRTTLMYPYGASSVKCAVCQFVTNVNMSNGRVPLPTNRPNGTACPPSTSTSTPPSQTQTVVVENPMSVDESGKLVSNVVVGVTTDKK 5EBEE628A30F1550 lsd1-lsd1 2 6 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain physical association physical association S1c and S1d amc1-lsd1 2 6 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain AtMC1 4 unspecified role unspecified role bait bait prodomain required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain physical association physical association S1c and S1d amc2-lsd1 2 AtMC2 5 unspecified role unspecified role bait bait prodomain required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain The full length form of mca2 does not interact with lsd1. 6 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain physical association physical association S1c and S1d The authors state that this interactions was weakly detected and could not be confirmed by other methods. amc1-amc1 2 AtMC1 4 unspecified role unspecified role bait bait AtMC1 4 unspecified role unspecified role prey prey prodomain required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain physical association physical association S1c and S1d amc1-lsd1-1 1 AtMC1 4 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 6 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 1b amc1-lsd1-2 3 AtMC1 4 unspecified role unspecified role prey prey ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range prodomain required to bind necessary binding region required to bind mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role bait bait myc tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association S2A