IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Progesterone receptor membrane component 1 inhibits the activity of drug-metabolizing cytochromes P450 and binds to cytochrome P450 reductase. Progesterone receptor membrane component 1 inhibits the activity of drug-metabolizing cytochromes P450 and binds to cytochrome P450 reductase. Mol. Pharmacol. (0026-895X) 2011 imex curation Szczesna-Skorupa E., Kemper B. Cancer - Interactions investigated in the context of cancer There has been no clarification from the authors regarding the construct "C1(1–29)/GFP":- notably if it is derived from CYP2C2 (as stated in this publication in the results section) or from CYP2C1, as given in the quoted reference:- Szczesna-Skorupa et al., 1998. (There is a 3 amino acid difference between the two sequences.) I have been unable to determine the species of EGFR in Transmemberane domain in "EBI-6251864". EBI-6251623 has not been deleted as the construct is slightly different - no EGFR "tag". If no email reply - remove C1 (1-29) interactions (weak) stating that authors have not confirmed if the identity of "C1" is C2 or C1...(I have not removed this - just entered a caution statement). In figure 8B participants were subsequently identified by molecular weight. C1(1–29)/GFP was found to contain the first 29 amino acids from Rabbit CYP2C1 - Ahn et al,. JBC 1993. OEC is a fusion protein assembled from the catalytic cytosolic domain (amino acids 21–490) of CYP2C2 fused to the transmembrane domain of epidermal growth factor receptor (EGFR- species undetermined), -which replaces the deleted CYP2C2 signal peptide. byronkem@life.illinois.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Szczesna-Skorupa E., Kemper B. Cancer - Interactions investigated in the context of cancer There has been no clarification from the authors regarding the construct "C1(1–29)/GFP":- notably if it is derived from CYP2C2 (as stated in this publication in the results section) or from CYP2C1, as given in the quoted reference:- Szczesna-Skorupa et al., 1998. (There is a 3 amino acid difference between the two sequences.) I have been unable to determine the species of EGFR in Transmemberane domain in "EBI-6251864". EBI-6251623 has not been deleted as the construct is slightly different - no EGFR "tag". If no email reply - remove C1 (1-29) interactions (weak) stating that authors have not confirmed if the identity of "C1" is C2 or C1...(I have not removed this - just entered a caution statement). In figure 8B participants were subsequently identified by molecular weight. C1(1–29)/GFP was found to contain the first 29 amino acids from Rabbit CYP2C1 - Ahn et al,. JBC 1993. OEC is a fusion protein assembled from the catalytic cytosolic domain (amino acids 21–490) of CYP2C2 fused to the transmembrane domain of epidermal growth factor receptor (EGFR- species undetermined), -which replaces the deleted CYP2C2 signal peptide. byronkem@life.illinois.edu Accepted 2012-AUG-09 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Mol. Pharmacol. (0026-895X) 2011 Only protein-protein interactions imex curation Progesterone receptor membrane component 1 inhibits the activity of drug-metabolizing cytochromes P450 and binds to cytochrome P450 reductase. Progesterone receptor membrane component 1 inhibits the activity of drug-metabolizing cytochromes P450 and binds to cytochrome P450 reductase. Mol. Pharmacol. (0026-895X) 2011 imex curation Szczesna-Skorupa E., Kemper B. Cancer - Interactions investigated in the context of cancer There has been no clarification from the authors regarding the construct "C1(1–29)/GFP":- notably if it is derived from CYP2C2 (as stated in this publication in the results section) or from CYP2C1, as given in the quoted reference:- Szczesna-Skorupa et al., 1998. (There is a 3 amino acid difference between the two sequences.) I have been unable to determine the species of EGFR in Transmemberane domain in "EBI-6251864". EBI-6251623 has not been deleted as the construct is slightly different - no EGFR "tag". If no email reply - remove C1 (1-29) interactions (weak) stating that authors have not confirmed if the identity of "C1" is C2 or C1...(I have not removed this - just entered a caution statement). In figure 8B participants were subsequently identified by molecular weight. C1(1–29)/GFP was found to contain the first 29 amino acids from Rabbit CYP2C1 - Ahn et al,. JBC 1993. OEC is a fusion protein assembled from the catalytic cytosolic domain (amino acids 21–490) of CYP2C2 fused to the transmembrane domain of epidermal growth factor receptor (EGFR- species undetermined), -which replaces the deleted CYP2C2 signal peptide. byronkem@life.illinois.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Szczesna-Skorupa E., Kemper B. Cancer - Interactions investigated in the context of cancer There has been no clarification from the authors regarding the construct "C1(1–29)/GFP":- notably if it is derived from CYP2C2 (as stated in this publication in the results section) or from CYP2C1, as given in the quoted reference:- Szczesna-Skorupa et al., 1998. (There is a 3 amino acid difference between the two sequences.) I have been unable to determine the species of EGFR in Transmemberane domain in "EBI-6251864". EBI-6251623 has not been deleted as the construct is slightly different - no EGFR "tag". If no email reply - remove C1 (1-29) interactions (weak) stating that authors have not confirmed if the identity of "C1" is C2 or C1...(I have not removed this - just entered a caution statement). In figure 8B participants were subsequently identified by molecular weight. C1(1–29)/GFP was found to contain the first 29 amino acids from Rabbit CYP2C1 - Ahn et al,. JBC 1993. OEC is a fusion protein assembled from the catalytic cytosolic domain (amino acids 21–490) of CYP2C2 fused to the transmembrane domain of epidermal growth factor receptor (EGFR- species undetermined), -which replaces the deleted CYP2C2 signal peptide. byronkem@life.illinois.edu Accepted 2012-AUG-09 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Mol. Pharmacol. (0026-895X) 2011 Only protein-protein interactions imex curation Progesterone receptor membrane component 1 inhibits the activity of drug-metabolizing cytochromes P450 and binds to cytochrome P450 reductase. Progesterone receptor membrane component 1 inhibits the activity of drug-metabolizing cytochromes P450 and binds to cytochrome P450 reductase. Mol. Pharmacol. (0026-895X) 2011 imex curation Szczesna-Skorupa E., Kemper B. Cancer - Interactions investigated in the context of cancer There has been no clarification from the authors regarding the construct "C1(1–29)/GFP":- notably if it is derived from CYP2C2 (as stated in this publication in the results section) or from CYP2C1, as given in the quoted reference:- Szczesna-Skorupa et al., 1998. (There is a 3 amino acid difference between the two sequences.) I have been unable to determine the species of EGFR in Transmemberane domain in "EBI-6251864". EBI-6251623 has not been deleted as the construct is slightly different - no EGFR "tag". If no email reply - remove C1 (1-29) interactions (weak) stating that authors have not confirmed if the identity of "C1" is C2 or C1...(I have not removed this - just entered a caution statement). In figure 8B participants were subsequently identified by molecular weight. C1(1–29)/GFP was found to contain the first 29 amino acids from Rabbit CYP2C1 - Ahn et al,. JBC 1993. OEC is a fusion protein assembled from the catalytic cytosolic domain (amino acids 21–490) of CYP2C2 fused to the transmembrane domain of epidermal growth factor receptor (EGFR- species undetermined), -which replaces the deleted CYP2C2 signal peptide. byronkem@life.illinois.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Szczesna-Skorupa E., Kemper B. Cancer - Interactions investigated in the context of cancer There has been no clarification from the authors regarding the construct "C1(1–29)/GFP":- notably if it is derived from CYP2C2 (as stated in this publication in the results section) or from CYP2C1, as given in the quoted reference:- Szczesna-Skorupa et al., 1998. (There is a 3 amino acid difference between the two sequences.) I have been unable to determine the species of EGFR in Transmemberane domain in "EBI-6251864". EBI-6251623 has not been deleted as the construct is slightly different - no EGFR "tag". If no email reply - remove C1 (1-29) interactions (weak) stating that authors have not confirmed if the identity of "C1" is C2 or C1...(I have not removed this - just entered a caution statement). In figure 8B participants were subsequently identified by molecular weight. C1(1–29)/GFP was found to contain the first 29 amino acids from Rabbit CYP2C1 - Ahn et al,. JBC 1993. OEC is a fusion protein assembled from the catalytic cytosolic domain (amino acids 21–490) of CYP2C2 fused to the transmembrane domain of epidermal growth factor receptor (EGFR- species undetermined), -which replaces the deleted CYP2C2 signal peptide. byronkem@life.illinois.edu Accepted 2012-AUG-09 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Mol. Pharmacol. (0026-895X) 2011 Only protein-protein interactions imex curation Progesterone receptor membrane component 1 inhibits the activity of drug-metabolizing cytochromes P450 and binds to cytochrome P450 reductase. Progesterone receptor membrane component 1 inhibits the activity of drug-metabolizing cytochromes P450 and binds to cytochrome P450 reductase. Mol. Pharmacol. (0026-895X) 2011 imex curation Szczesna-Skorupa E., Kemper B. Cancer - Interactions investigated in the context of cancer There has been no clarification from the authors regarding the construct "C1(1–29)/GFP":- notably if it is derived from CYP2C2 (as stated in this publication in the results section) or from CYP2C1, as given in the quoted reference:- Szczesna-Skorupa et al., 1998. (There is a 3 amino acid difference between the two sequences.) I have been unable to determine the species of EGFR in Transmemberane domain in "EBI-6251864". EBI-6251623 has not been deleted as the construct is slightly different - no EGFR "tag". If no email reply - remove C1 (1-29) interactions (weak) stating that authors have not confirmed if the identity of "C1" is C2 or C1...(I have not removed this - just entered a caution statement). In figure 8B participants were subsequently identified by molecular weight. C1(1–29)/GFP was found to contain the first 29 amino acids from Rabbit CYP2C1 - Ahn et al,. JBC 1993. OEC is a fusion protein assembled from the catalytic cytosolic domain (amino acids 21–490) of CYP2C2 fused to the transmembrane domain of epidermal growth factor receptor (EGFR- species undetermined), -which replaces the deleted CYP2C2 signal peptide. byronkem@life.illinois.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Szczesna-Skorupa E., Kemper B. Cancer - Interactions investigated in the context of cancer There has been no clarification from the authors regarding the construct "C1(1–29)/GFP":- notably if it is derived from CYP2C2 (as stated in this publication in the results section) or from CYP2C1, as given in the quoted reference:- Szczesna-Skorupa et al., 1998. (There is a 3 amino acid difference between the two sequences.) I have been unable to determine the species of EGFR in Transmemberane domain in "EBI-6251864". EBI-6251623 has not been deleted as the construct is slightly different - no EGFR "tag". If no email reply - remove C1 (1-29) interactions (weak) stating that authors have not confirmed if the identity of "C1" is C2 or C1...(I have not removed this - just entered a caution statement). In figure 8B participants were subsequently identified by molecular weight. C1(1–29)/GFP was found to contain the first 29 amino acids from Rabbit CYP2C1 - Ahn et al,. JBC 1993. OEC is a fusion protein assembled from the catalytic cytosolic domain (amino acids 21–490) of CYP2C2 fused to the transmembrane domain of epidermal growth factor receptor (EGFR- species undetermined), -which replaces the deleted CYP2C2 signal peptide. byronkem@life.illinois.edu Accepted 2012-AUG-09 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Mol. Pharmacol. (0026-895X) 2011 Only protein-protein interactions imex curation Progesterone receptor membrane component 1 inhibits the activity of drug-metabolizing cytochromes P450 and binds to cytochrome P450 reductase. Progesterone receptor membrane component 1 inhibits the activity of drug-metabolizing cytochromes P450 and binds to cytochrome P450 reductase. Mol. Pharmacol. (0026-895X) 2011 imex curation Szczesna-Skorupa E., Kemper B. Cancer - Interactions investigated in the context of cancer There has been no clarification from the authors regarding the construct "C1(1–29)/GFP":- notably if it is derived from CYP2C2 (as stated in this publication in the results section) or from CYP2C1, as given in the quoted reference:- Szczesna-Skorupa et al., 1998. (There is a 3 amino acid difference between the two sequences.) I have been unable to determine the species of EGFR in Transmemberane domain in "EBI-6251864". EBI-6251623 has not been deleted as the construct is slightly different - no EGFR "tag". If no email reply - remove C1 (1-29) interactions (weak) stating that authors have not confirmed if the identity of "C1" is C2 or C1...(I have not removed this - just entered a caution statement). In figure 8B participants were subsequently identified by molecular weight. C1(1–29)/GFP was found to contain the first 29 amino acids from Rabbit CYP2C1 - Ahn et al,. JBC 1993. OEC is a fusion protein assembled from the catalytic cytosolic domain (amino acids 21–490) of CYP2C2 fused to the transmembrane domain of epidermal growth factor receptor (EGFR- species undetermined), -which replaces the deleted CYP2C2 signal peptide. byronkem@life.illinois.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Szczesna-Skorupa E., Kemper B. Cancer - Interactions investigated in the context of cancer There has been no clarification from the authors regarding the construct "C1(1–29)/GFP":- notably if it is derived from CYP2C2 (as stated in this publication in the results section) or from CYP2C1, as given in the quoted reference:- Szczesna-Skorupa et al., 1998. (There is a 3 amino acid difference between the two sequences.) I have been unable to determine the species of EGFR in Transmemberane domain in "EBI-6251864". EBI-6251623 has not been deleted as the construct is slightly different - no EGFR "tag". If no email reply - remove C1 (1-29) interactions (weak) stating that authors have not confirmed if the identity of "C1" is C2 or C1...(I have not removed this - just entered a caution statement). In figure 8B participants were subsequently identified by molecular weight. C1(1–29)/GFP was found to contain the first 29 amino acids from Rabbit CYP2C1 - Ahn et al,. JBC 1993. OEC is a fusion protein assembled from the catalytic cytosolic domain (amino acids 21–490) of CYP2C2 fused to the transmembrane domain of epidermal growth factor receptor (EGFR- species undetermined), -which replaces the deleted CYP2C2 signal peptide. byronkem@life.illinois.edu Accepted 2012-AUG-09 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Mol. Pharmacol. (0026-895X) 2011 Only protein-protein interactions imex curation Progesterone receptor membrane component 1 inhibits the activity of drug-metabolizing cytochromes P450 and binds to cytochrome P450 reductase. Progesterone receptor membrane component 1 inhibits the activity of drug-metabolizing cytochromes P450 and binds to cytochrome P450 reductase. Mol. Pharmacol. (0026-895X) 2011 imex curation Szczesna-Skorupa E., Kemper B. Cancer - Interactions investigated in the context of cancer There has been no clarification from the authors regarding the construct "C1(1–29)/GFP":- notably if it is derived from CYP2C2 (as stated in this publication in the results section) or from CYP2C1, as given in the quoted reference:- Szczesna-Skorupa et al., 1998. (There is a 3 amino acid difference between the two sequences.) I have been unable to determine the species of EGFR in Transmemberane domain in "EBI-6251864". EBI-6251623 has not been deleted as the construct is slightly different - no EGFR "tag". If no email reply - remove C1 (1-29) interactions (weak) stating that authors have not confirmed if the identity of "C1" is C2 or C1...(I have not removed this - just entered a caution statement). In figure 8B participants were subsequently identified by molecular weight. C1(1–29)/GFP was found to contain the first 29 amino acids from Rabbit CYP2C1 - Ahn et al,. JBC 1993. OEC is a fusion protein assembled from the catalytic cytosolic domain (amino acids 21–490) of CYP2C2 fused to the transmembrane domain of epidermal growth factor receptor (EGFR- species undetermined), -which replaces the deleted CYP2C2 signal peptide. byronkem@life.illinois.edu 19-Sept-2012: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Szczesna-Skorupa E., Kemper B. Cancer - Interactions investigated in the context of cancer There has been no clarification from the authors regarding the construct "C1(1–29)/GFP":- notably if it is derived from CYP2C2 (as stated in this publication in the results section) or from CYP2C1, as given in the quoted reference:- Szczesna-Skorupa et al., 1998. (There is a 3 amino acid difference between the two sequences.) I have been unable to determine the species of EGFR in Transmemberane domain in "EBI-6251864". EBI-6251623 has not been deleted as the construct is slightly different - no EGFR "tag". If no email reply - remove C1 (1-29) interactions (weak) stating that authors have not confirmed if the identity of "C1" is C2 or C1...(I have not removed this - just entered a caution statement). In figure 8B participants were subsequently identified by molecular weight. C1(1–29)/GFP was found to contain the first 29 amino acids from Rabbit CYP2C1 - Ahn et al,. JBC 1993. OEC is a fusion protein assembled from the catalytic cytosolic domain (amino acids 21–490) of CYP2C2 fused to the transmembrane domain of epidermal growth factor receptor (EGFR- species undetermined), -which replaces the deleted CYP2C2 signal peptide. byronkem@life.illinois.edu Accepted 2012-AUG-09 by ORCHARD 19-Sept-2012: Contacted by IntAct-Help. Mol. Pharmacol. (0026-895X) 2011 Only protein-protein interactions imex curation pgrc1_human Membrane-associated progesterone receptor component 1 Dap1 IZA PGRMC1 HPR6.6 PGRMC protein protein human Homo sapiens Human MAAEDVVATGADPSDLESGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND CCD5E802E1C9E604 insi1_human Insulin-induced gene 1 protein INSIG1 protein protein human Homo sapiens Human MPRLHDHFWSCSCAHSARRRGPPRASAAGLAAKVGEMINVSVSGPSLLAAHGAPDADPAPRGRSAAMSGPEPGSPYPNTWHHRLLQRSLVLFSVGVVLALVLNLLQIQRNVTLFPEEVIATIFSSAWWVPPCCGTAAAVVGLLYPCIDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDRSRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQLAMGVPEKPHSD 198068D53C658A58 bap31_human B-cell receptor-associated protein 31 BCAP31 BAP31 p28 6C6-AG tumor-associated antigen DXS1357E Protein CDM protein protein human Homo sapiens Human MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE D34367F870D6EB00 ncpr_human NADPH--cytochrome P450 reductase POR CYPOR protein protein human Homo sapiens Human MGDSHVDTSSTVSEAVAEEVSLFSMTDMILFSLIVGLLTYWFLFRKKKEEVPEFTKIQTLTSSVRESSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEYDLADLSSLPEIDNALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATGEESSIRQYELVVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTERHLMHLELDISDSKIRYESGDHVAVYPANDSALVNQLGKILGADLDVVMSLNNLDEESNKKHPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPSEQELLRKMASSSGEGKELYLSWVVEARRHILAILQDCPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVVVEYETKAGRINKGVATNWLRAKEPAGENGGRALVPMFVRKSQFRLPFKATTPVIMVGPGTGVAPFIGFIQERAWLRQQGKEVGETLLYYGCRRSDEDYLYREELAQFHRDGALTQLNVAFSREQSHKVYVQHLLKQDREHLWKLIEGGAHIYVCGDARNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTKGRYSLDVWS DIP protein P16435 original sequence version: 103 2F7D4B9CDFDF5A74 cp2c1_rabit Cytochrome P450 2C1 CYP2C1 CYPIIC1 Cytochrome P-450 IIC1 Cytochrome P450 PBc1 protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MDPVVVLGLCLSCLLLLSLWKQSYGGGKLPPGPTPFPILGNILQIGIQDISKSFTKLSEVYGPVFTVYLGMKPTVVIHGYDAVKEALVDLGEEFSGRIVFPLTAKINKGYGIVFSNGKRWKETRRFSLMTLRDFGMGKRSIEDRVQEEARCLVEELRKTNGSPCNPTFILGAAPCNVICSVIFQNRFDYTDQDFLSLMGKLNENFKILNSPWVQMCNNFPILIDYLPGSHNKILRNNIYIRNYVLEKIKEHQETLDINNPRDFIDCFLIKMEQEKDNQQSEFTIENLMTTLSDVFGAGTETTSTTLRYGLLLLMKHPEVIAKVQEEIERVIGRHRSPCMQDRSRMPYTDATVHEIQRYINLIPNNVPRATTCNVKFRSYLIPKGTAVITSLTSMLYNDKEFPNPDRFDPGHFLDASGKFRKSDYFMPFSTGKRVCVGEVLARMELFLFLTAILQNFTPKPLVDPKDIDTTPLVSGLGRVPPLYQLSFIPA 2054D538A83E7D17 cp3a4_human Cytochrome P450 3A4 Albendazole monooxygenase (sulfoxide-forming) CYP3A4 CYP3A3 Albendazole sulfoxidase CYPIIIA3 CYPIIIA4 Cytochrome P450 3A3 Cytochrome P450 HLp Cytochrome P450 NF-25 Cytochrome P450-PCN1 Nifedipine oxidase Quinine 3-monooxygenase 1,8-cineole 2-exo-monooxygenase Cholesterol 25-hydroxylase 1,4-cineole 2-exo-monooxygenase protein protein human Homo sapiens Human MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPGPTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQPVLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISIAEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICVFPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA 38ED122BF89F74F7 cp2c8_human Cytochrome P450 2C8 CYP2C8 CYPIIC8 Cytochrome P450 IIC2 Cytochrome P450 MP-12 Cytochrome P450 MP-20 Cytochrome P450 form 1 S-mephenytoin 4-hydroxylase protein protein human Homo sapiens Human MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDICKSFTNFSKVYGPVFTVYFGMNPIVVFHGYEAVKEALIDNGEEFSGRGNSPISQRITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRSIEDRVQEEAHCLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTETTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDAVVHEIQRYSDLVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKEFPNPNIFDPGHFLDKNGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLTTILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV E920EB2084F477E1 cp2c2_rabit Cytochrome P450 2C2 CYP2C2 CYPIIC2 Cytochrome P450 PBc2 Cytochrome P450 PHP2 Laurate omega-1 hydroxylase protein protein rabit Oryctolagus cuniculus (Rabbit) Rabbit MDLVVVLGLCLSCLLLPSLWKQSHGGGKLPPGPTPFPILGNVLQLDFKDLSKSLTNLSKVYGPVFTVYLGMKPTVVVHGYEAVKEALVDLGHELSGRSRFLVTAKLNKGFGVIFSNGKRWTETRRFSLMTLRNFGMGKRSIEERVQEEAHCLVEELRKTNASPCDPTFILGAAPCNVICSVIFQNRFDYTDQDFLSLMGKFNENFKILNSPWVQFCNCFPILFDYFPGSHRKAVKNIFYVKNYITEQIKEHQKSLDINNPRDFIDCFLIKMEQEKCNQQSEFTIENLLTTVSDVFMAGTETTSTTLRYGLLLLMKHPEVIAKVQEEIERVIGRHRSPCMQDRSRMPYTDATVHEIQRYINLIPNNVPHTTICNLKFRNYLIPKGTDVLTSLSSVLHDDKEFPNPDRFDPGHFLDASGNFRKSDYFMPFSTGKRVCVGEALARMELFLFLTAILQNFTPKPLVNPNNVDENPFSSGIVRVPPLYRVSFIPV C105A6C6F3687E23 pgrmc1-cyp2c2 1 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 1A cyp3a4-pgrmc1 3 7 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role bait bait region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 1A cyp2c8-cyp2c2 1 13 unspecified role unspecified role bait bait c_terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 1A pgrmc1-cyp2c2-1 1 11 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 1B the chimera OEC/GFP binds much more efficiently to PGRMC1 than C1(1–29)/GFP, consistent with an interaction mediated mainly by the cytosolic domain of CYP2C2 (Fig. 1B, left). It is possible that the construct "C1(1–29)/GFP" may have been derived from CYP2C2 rather than CYP2C1- as entered here. pgrmc1-cyp2c2 1 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cytoplasmic_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain egfr_transmembrane_domain tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 1B the chimera OEC/GFP binds much more efficiently to PGRMC1 than C1(1–29)/GFP, consistent with an interaction mediated mainly by the cytosolic domain of CYP2C2 (Fig. 1B, left). cyp2c2-bcap31 6 9 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 1B cyp2c2-pgrmc1 5 7 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role neutral component neutral component c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Fig 2A cyp2c2-pgrmc1-1 2 7 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role neutral component neutral component c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization Fig 2A/B cyp3a4-pgrmc1-2 5 7 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 2A pgrmc1-por 6 10 unspecified role unspecified role prey prey c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 8A cyp2c2-por 6 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 8A pgrmc1-cyp2c2-3 1 14 unspecified role unspecified role prey prey c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role prey prey c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 8B In cells coexpressing all three proteins, there was a marked decrease in CPR binding to PGRMC1, whereas binding of PGRMC1 to CYP2C2 was little changed. pgrmc1-cyp2c2-2 1 14 unspecified role unspecified role prey prey c_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 8B pgrmc1-cyp2c2-4 1 7 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 8B por-cyp2c2 4 7 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 14 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig 8C -1 only weak binding of PGRMC1 to CPR was observed (Fig. 8C, third panel). por-cyp2c2-1 4 14 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig 8C -2 In cells coexpressing all three proteins, there was a marked decrease in CPR binding to PGRMC1, whereas binding of PGRMC1 to CYP2C2 was little changed. cyp3a4-pgrmc1-3 5 7 unspecified role unspecified role neutral component neutral component region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig 9A por-cyp2c2-2 1 14 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 10A binding of INSIG1 to CYP2C2 is independent of PGRMC1. cyp2c2-insig1 1 14 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 10A Binding of INSIG1 to CYP2C2 is independent of PGRMC1. por-cyp2c2-3 3 10 unspecified role unspecified role bait bait c_terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 14 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 10B pgrmc1-cyp2c1 1 8 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig 10C -1 Coimmunoprecipitation of INSIG1 and chimera C1(1–29)/GFP is more efficient than that with the cytoplasmic domain chimera OEC/GFP. [OEC is a fusion protein assembled from the catalytic cytosolic domain (amino acids 21–490) of CYP2C2 fused to the transmembrane domain of epidermal growth factor receptor (EGFR- species undetermined), -which replaces the deleted CYP2C2 signal peptide.] cyp2c1-insig1 1 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role bait bait n_terminal_region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 10C -2 Coimmunoprecipitation of INSIG1 and chimera C1(1–29)/GFP is more efficient than that with the cytoplasmic domain chimera OEC/GFP. cyp2c2-insig1-1 1 8 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 14 unspecified role unspecified role bait bait egfr_transmembrane_domain tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined cytoplasmic_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig 10C-3 Coimmunoprecipitation of INSIG1 and chimera C1(1–29)/GFP is more efficient than that with the cytoplasmic domain chimera OEC/GFP (Fig. 10C). have not entered reverse IP as the band is very faint.