mpidb The Microbial Protein Interaction Database BglJ-RcsB heterodimers relieve repression of the Escherichia coli bgl operon by H-NS BglJ-RcsB heterodimers relieve repression of the Escherichia coli bgl operon by H-NS J. Bacteriol. (0021-9193) 2010 imex curation Venkatesh GR , Kembou Koungni FC , Paukner A , Stratmann T , Blissenbach B , Schnetz K 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Venkatesh GR , Kembou Koungni FC , Paukner A , Stratmann T , Blissenbach B , Schnetz K Accepted 2012-DEC-13 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation BglJ-RcsB heterodimers relieve repression of the Escherichia coli bgl operon by H-NS BglJ-RcsB heterodimers relieve repression of the Escherichia coli bgl operon by H-NS J. Bacteriol. (0021-9193) 2010 imex curation Venkatesh GR , Kembou Koungni FC , Paukner A , Stratmann T , Blissenbach B , Schnetz K 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli gallex lex-a dimerization assay gallex predetermined predetermined participant predetermined Venkatesh GR , Kembou Koungni FC , Paukner A , Stratmann T , Blissenbach B , Schnetz K Accepted 2012-DEC-13 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation rcsb_ecoli Transcriptional regulatory protein RcsB rcsB Capsular synthesis regulator component B JW2205 b2217 protein protein ecoli Escherichia coli (strain K12) MNNMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPSLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRLLEKISAGGYGDKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVTLSPADKD This sequence has been withdrawn from Uniprot. A78D1BD3004E0680 A78D1BD3004E0680 yjjq_ecoli Putative transcription factor YjjQ yjjQ JW4329 b4365 protein protein ecoli Escherichia coli (strain K12) MLPGCCKNGIVISKIPVMQAGLKEVMRTHFPEYEIISSASAEDLTLLQLRRSGLVIADLAGESEDPRSVCEHYYSLISQYREIHWVFMVSRSWYSQAVELLMCPTATLLSDVEPIENLVKTVRSGNTHAERISAMLTSPAMTETHDFSYRSVILTLSERKVLRLLGKGWGINQIASLLKKSNKTISAQKNSAMRRLAIHSNAEMYAWINSAQGARELNLPSVYGDAAEWNTAELRREMSHS 83DF457B46AE230F bglj_ecoli Transcriptional activator protein BglJ yjjR bglJ b4366 JW5955 protein protein ecoli Escherichia coli (strain K12) MEHSRIKKRNVALIEKCVMSSIGIESLFRKFAGNPYKLHTYTSQESFQDAMSRISFAAVIFSFSAMRSERREGLSCLTELAIKFPRTRRLVIADDDIEARLIGSLSPSPLDGVLSKASTLEIFHQELFLSLNGVRQATDRLNNQWYINQSRTLSPTEREILRFMSRGYSMTQIAEQLKRNIKTIRAHKFNVMSKLGVSSDAGLLEAADILLCMRHCETSNVLHPY DIP protein P39404 original sequence version: null 5EED6E444409A010 rcsa_ecoli Transcriptional regulatory protein RcsA rcsA Colanic acid capsular biosynthesis activation protein A JW1935 b1951 protein protein ecoli Escherichia coli (strain K12) MSTIIMDLCSYTRLGLTGYLLSRGVKKREINDIETVDDLAIACDSQRPSVVFINEDCFIHDASNSQRIKLIINQHPNTLFIVFMAIANVHFDEYLLVRKNLLISSKSIKPESLDDILGDILKKETTITSFLNMPTLSLSRTESSMLRMWMAGQGTIQISDQMNIKAKTVSSHKGNIKRKIKTHNKQVIYHVVRLTDNVTNGIFVNMR This sequence has been withdrawn from Uniprot. 6DAA22097807AF62 6DAA22097807AF62 bglj-rcsb 2 5 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association figure 2C rcsa-rcsb-2 2 6 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey P0DMC7:p.Asp56Glu P69407-56-56 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D E Wed May 02 16:42:51 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp56glu' Tue Jun 30 18:32:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp56Glu' physical association physical association figure 2C rcsb-rcsb 2 3 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Fig. 2B bglj-bglj 2 5 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Fig. 2B yjjq-yjjq 2 4 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association figure 2B rcsb-bglj 1 3 unspecified role unspecified role bait bait p69407-- P69407-- ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey p39404-- P39404-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association figure 3