mpidb The Microbial Protein Interaction Database Crl binds to domain 2 of σ(S) and confers a competitive advantage on a natural rpoS mutant of Salmonella enterica serovar Typhi. Crl binds to domain 2 of σ(S) and confers a competitive advantage on a natural rpoS mutant of Salmonella enterica serovar Typhi. J. Bacteriol. (0021-9193) 2010 imex curation Monteil V., Kolb A., Mayer C., Hoos S., England P., Norel F. 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Monteil V., Kolb A., Mayer C., Hoos S., England P., Norel F. Accepted 2012-DEC-12 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation rpos_salti RNA polymerase sigma factor RpoS rpoS Sigma-38 katF STY3049 t2825 Sigma S protein protein salti Salmonella typhi MSQNTLKVHDLNEDAEFDENGVEAFDEKALSEEEPSDNDLAEEELLSQGATQRVLDATQLYLGEIGYSPLLTAEEEVYFARRALRGDVASRRRMIESNLRLVVKIARRYGNRGLALLDLIEEGNLGLIRAVEKFDPERGFRFSTYATWWIRQTIERAIMNQTRTIRLPIHIVKELNVYLRTARELSHKLDHEPSAEEIAEQLDKPVDDVSRMLRLNERITSVDTPLGGDSEKALLDILADEKENGPEDTTQDDDMKQSIVKWLFELNAKQREVLARRFGLLGYEAATLEDVGREIGLTRERVRQIQVEGLRRLREILQTQGLNIEALFRE 4400E48DEB358ECC crl_salti Sigma factor-binding protein Crl STY0364 t2531 crl protein protein salti Salmonella typhi MTLPSGHPKSRLIKKFTALGPYIREGQCEDNRFFFDCLAVCVNVKPAPEKREFWGWWMELEAQEKRFTYRYQFGLFDKEGNWTVVPINETEVVERLEYTLREFHEKLRDLLISMELALEPSDDFNDEPVKLSA 0619C3D79FFF7897 crl-rpos 1 3 unspecified role unspecified role bait bait 2 unspecified role unspecified role prey prey region P0A2E6-255-330 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region P0A2E6-1-55 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P0A2E6:p.Gly282Val mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain G V Wed May 02 14:39:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly282val' Tue Jun 30 19:19:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly282Val' physical association physical association figure 4