IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The role of ezrin-associated protein network in human sperm capacitation. The role of ezrin-associated protein network in human sperm capacitation. Asian J. Androl. (1008-682X) 2010 imex curation Wang L., Chen W., Zhao C., Huo R., Guo X.J., Lin M., Huang X.Y., Mao Y.D., Zhou Z.M., Sha J.H. Found this paper after I had deleted a publication from Arathi containing an Ezrin-Cd44 colocalisation (nowt else, and no other evidence of any Ezrin-Cd44 interactions) -but this appears to be a well known interaction - but could find only a 2002 reference to it. So searched for more - and this is the first results. Antibody specificity is a potentail problem for both Ezrin and CD44 abs. drmaoyd@yahoo.com.cn, zhouzm@njm.edu.cn 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-sperm Homo sapiens - sperm sperm anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wang L., Chen W., Zhao C., Huo R., Guo X.J., Lin M., Huang X.Y., Mao Y.D., Zhou Z.M., Sha J.H. The interaction between Ezrin and Actin has not been annotated as the type of Actin is not specified. Found this paper after I had deleted a publication from Arathi containing an Ezrin-Cd44 colocalisation (nowt else, and no other evidence of any Ezrin-Cd44 interactions) -but this appears to be a well known interaction - but could find only a 2002 reference to it. So searched for more - and this is the first results. Antibody specificity is a potentail problem for both Ezrin and CD44 abs. drmaoyd@yahoo.com.cn, zhouzm@njm.edu.cn Accepted 2012-APR-30 by JYOTI 20-Jun-2012: Contacted by JYOTI. Asian J. Androl. (1008-682X) 2010 Only protein-protein interactions imex curation done.. The role of ezrin-associated protein network in human sperm capacitation. The role of ezrin-associated protein network in human sperm capacitation. Asian J. Androl. (1008-682X) 2010 imex curation Wang L., Chen W., Zhao C., Huo R., Guo X.J., Lin M., Huang X.Y., Mao Y.D., Zhou Z.M., Sha J.H. Found this paper after I had deleted a publication from Arathi containing an Ezrin-Cd44 colocalisation (nowt else, and no other evidence of any Ezrin-Cd44 interactions) -but this appears to be a well known interaction - but could find only a 2002 reference to it. So searched for more - and this is the first results. Antibody specificity is a potentail problem for both Ezrin and CD44 abs. drmaoyd@yahoo.com.cn, zhouzm@njm.edu.cn 20-Jun-2012: Contacted by JYOTI. Only protein-protein interactions human-sperm Homo sapiens - sperm sperm fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining Wang L., Chen W., Zhao C., Huo R., Guo X.J., Lin M., Huang X.Y., Mao Y.D., Zhou Z.M., Sha J.H. Found this paper after I had deleted a publication from Arathi containing an Ezrin-Cd44 colocalisation (nowt else, and no other evidence of any Ezrin-Cd44 interactions) -but this appears to be a well known interaction - but could find only a 2002 reference to it. So searched for more - and this is the first results. Antibody specificity is a potentail problem for both Ezrin and CD44 abs. drmaoyd@yahoo.com.cn, zhouzm@njm.edu.cn Accepted 2012-APR-30 by JYOTI Asian J. Androl. (1008-682X) 2010 Only protein-protein interactions imex curation done.. rhoa_human Transforming protein RhoA Rho cDNA clone 12 ARHA RHO12 RHOA ARH12 protein protein human Homo sapiens Human MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL DIP protein P61586 original sequence version: 86 DIP protein P61586 original sequence version: 123 DIP protein P61586 original sequence version: 57 DIP protein P61586 original sequence version: 88 DIP protein P61586 original sequence version: 87 DIP protein P61586 original sequence version: 85 DIP protein P61586 original sequence version: 125 DIP protein P61586 original sequence version: 132 C4DA2DC31FF858BC gdir1_human Rho GDP-dissociation inhibitor 1 Rho-GDI alpha ARHGDIA GDIA1 protein protein human Homo sapiens Human MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKKDWKD 59CB6F42E3B3BCCA cd44_human CD44 antigen Epican CDw44 Phagocytic glycoprotein I Extracellular matrix receptor III HUTCH-I Phagocytic glycoprotein 1 GP90 lymphocyte homing/adhesion receptor Hermes antigen Hyaluronate receptor Heparan sulfate proteoglycan CD44 LHR MDU2 MDU3 MIC4 protein protein human Homo sapiens Human MDKFWWHAAWGLCLVPLSLAQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATTLMSTSATATETATKRQETWDWFSWLFLPSESKNHLHTTTQMAGTSSNTISAGWEPNEENEDERDRHLSFSGSGIDDDEDFISSTISTTPRAFDHTKQNQDWTQWNPSHSNPEVLLQTTTRMTDVDRNGTTAYEGNWNPEAHPPLIHHEHHEEEETPHSTSTIQATPSSTTEETATQKEQWFGNRWHEGYRQTPKEDSHSTTGTAAASAHTSHPMQGRTTPSPEDSSWTDFFNPISHPMGRGHQAGRRMDMDSSHSITLQPTANPNTGLVEDLDRTGPLSMTTQQSNSQSFSTSHEGLEEDKDHPTTSTLTSSNRNDVTGGRRDPNHSEGSTTLLEGYTSHYPHTKESRTFIPVTSAKTGSFGVTAVTVGDSNSNVNRSLSGDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINSGNGAVEDRKPSGLNGEASKSQEMVHLVNKESSETPDQFMTADETRNLQNVDMKIGV DIP protein P16070 original sequence version: 142 DIP protein P16070 original sequence version: 157 BB9B66B19B970349 ezri_human Ezrin EZR VIL2 p81 Cytovillin Villin-2 protein protein human Homo sapiens Human MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEPVSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL DIP protein P15311 original sequence version: 170 DIP protein P15311 original sequence version: 142 F1B592CF49A7CC46 arhgdia-ezr 2 4 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 1C ezr-arhgdia 1 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association Fig 2C rhoa-arhgdia 1 4 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association Fig 2C ezr-arhgdia-1 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Fig 3E Ezrin interacts with the glycosylated and native forms of cd44 after capacitation.