UniProt UniProt http://www.uniprot.org DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation. DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation. Mol. Immunol. (0161-5890) 2010 mimix curation Eleveld-Trancikova D., Sanecka A., van Hout-Kuijer M.A., Looman M.W., Hendriks I.A., Jansen B.J., Adema G.J. g.adema@ncmls.ru.nl 20-Jun-2012: Contacted by JYOTI. cDNAs isolated from immature and mature dendritic cells yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Eleveld-Trancikova D., Sanecka A., van Hout-Kuijer M.A., Looman M.W., Hendriks I.A., Jansen B.J., Adema G.J. g.adema@ncmls.ru.nl Accepted 2012-APR-20 by ORCHARD 20-Jun-2012: Contacted by JYOTI. cDNAs isolated from immature and mature dendritic cells Mol. Immunol. (0161-5890) 2010 mimix curation DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation. DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation. Mol. Immunol. (0161-5890) 2010 mimix curation Eleveld-Trancikova D., Sanecka A., van Hout-Kuijer M.A., Looman M.W., Hendriks I.A., Jansen B.J., Adema G.J. g.adema@ncmls.ru.nl 20-Jun-2012: Contacted by JYOTI. cDNAs isolated from immature and mature dendritic cells crigr Cricetulus griseus (Chinese hamster) Cricetulus barabensis griseus Chinese hamster confocal microscopy confocal microscopy immunostaining immunostaining Eleveld-Trancikova D., Sanecka A., van Hout-Kuijer M.A., Looman M.W., Hendriks I.A., Jansen B.J., Adema G.J. g.adema@ncmls.ru.nl Accepted 2012-APR-20 by ORCHARD 20-Jun-2012: Contacted by JYOTI. cDNAs isolated from immature and mature dendritic cells Mol. Immunol. (0161-5890) 2010 mimix curation DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation. DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation. Mol. Immunol. (0161-5890) 2010 mimix curation Eleveld-Trancikova D., Sanecka A., van Hout-Kuijer M.A., Looman M.W., Hendriks I.A., Jansen B.J., Adema G.J. g.adema@ncmls.ru.nl 20-Jun-2012: Contacted by JYOTI. cDNAs isolated from immature and mature dendritic cells human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Eleveld-Trancikova D., Sanecka A., van Hout-Kuijer M.A., Looman M.W., Hendriks I.A., Jansen B.J., Adema G.J. g.adema@ncmls.ru.nl Accepted 2012-APR-20 by ORCHARD 20-Jun-2012: Contacted by JYOTI. cDNAs isolated from immature and mature dendritic cells Mol. Immunol. (0161-5890) 2010 mimix curation DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation. DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation. Mol. Immunol. (0161-5890) 2010 mimix curation Eleveld-Trancikova D., Sanecka A., van Hout-Kuijer M.A., Looman M.W., Hendriks I.A., Jansen B.J., Adema G.J. g.adema@ncmls.ru.nl 20-Jun-2012: Contacted by JYOTI. cDNAs isolated from immature and mature dendritic cells yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Eleveld-Trancikova D., Sanecka A., van Hout-Kuijer M.A., Looman M.W., Hendriks I.A., Jansen B.J., Adema G.J. g.adema@ncmls.ru.nl Accepted 2012-APR-20 by ORCHARD cDNAs isolated from immature and mature dendritic cells Mol. Immunol. (0161-5890) 2010 mimix curation DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation. DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation. Mol. Immunol. (0161-5890) 2010 mimix curation Eleveld-Trancikova D., Sanecka A., van Hout-Kuijer M.A., Looman M.W., Hendriks I.A., Jansen B.J., Adema G.J. g.adema@ncmls.ru.nl 20-Jun-2012: Contacted by JYOTI. cDNAs isolated from immature and mature dendritic cells human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy immunostaining immunostaining Eleveld-Trancikova D., Sanecka A., van Hout-Kuijer M.A., Looman M.W., Hendriks I.A., Jansen B.J., Adema G.J. g.adema@ncmls.ru.nl Accepted 2012-APR-20 by ORCHARD 20-Jun-2012: Contacted by JYOTI. cDNAs isolated from immature and mature dendritic cells Mol. Immunol. (0161-5890) 2010 mimix curation o43889-2 Cyclic AMP-responsive element-binding protein 3 CREB3 LZIP Luman Transcription factor LZIP-alpha LZIP Leucine zipper protein protein protein human Homo sapiens Human MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG 82152E496B924EEC dcstp_human Dendritic cell-specific transmembrane protein DCSTAMP Dendrocyte-expressed seven transmembrane protein IL-four-induced protein TM7SF4 Transmembrane 7 superfamily member 4 protein protein human Homo sapiens Human MGIWTSGTDIFLSLWEIYVSPRSPGWMDFIQHLGVCCLVALISVGLLSVAACWFLPSIIAAAASWIITCVLLCCSKHARCFILLVFLSCGLREGRNALIAAGTGIVILGHVENIFHNFKGLLDGMTCNLRAKSFSIHFPLLKKYIEAIQWIYGLATPLSVFDDLVSWNQTLAVSLFSPSHVLEAQLNDSKGEVLSVLYQMATTTEVLSSLGQKLLAFAGLSLVLLGTGLFMKRFLGPCGWKYENIYITRQFVQFDERERHQQRPCVLPLNKEERRKYVIIPTFWPTPKERKNLGLFFLPILIHLCIWVLFAAVDYLLYRLIFSVSKQFQSLPGFEVHLKLHGEKQGTQDIIHDSSFNISVFEPNCIPKPKFLLSETWVPLSVILLILVMLGLLSSILMQLKILVSASFYPSVERKRIQYLHAKLLKKRSKQPLGEVKRRLSLYLTKIHFWLPVLKMIRKKQMDMASADKS EA2B858FD2C7560C os9_human Protein OS-9 OS9 Amplified in osteosarcoma 9 protein protein human Homo sapiens Human MAAETLLSSLLGLLLLGLLLPASLTGGVGSLNLEELSEMRYGIEILPLPVMGGQSQSSDVVIVSSKYKQRYECRLPAGAIHFQREREEETPAYQGPGIPELLSPMRDAPCLLKTKDWWTYEFCYGRHIQQYHMEDSEIKGEVLYLGYYQSAFDWDDETAKASKQHRLKRYHSQTYGNGSKCDLNGRPREAEVRFLCDEGAGISGDYIDRVDEPLSCSYVLTIRTPRLCPHPLLRPPPSAAPQAILCHPSLQPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGASPTKDDSKDSDFWKMLNEPEDQAPGGEEVPAEEQDPSPEAADSASGAPNDFQNNVQVKVIRSPADLIRFIEELKGGTKKGKPNIGQEQPVDDAAEVPQREPEKERGDPERQREMEEEEDEDEDEDEDEDERQLLGEFEKELEGILLPSDRDRLRSEVKAGMERELENIIQETEKELDPDGLKKESERDRAMLALTSTLNKLIKRLEEKQSPELVKKHKKKRVVPKKPPPSPQPTEEDPEHRVRVRVTKLRLGGPNQDLTVLEMKRENPQLKQIEGLVKELLEREGLTAAGKIEIKIVRPWAEGTEEGARWLTDEDTRNLKEIFFNILVPGAEEAQKERQRQKELESNYRRVWGSPGGEGTGDLDEFDF DIP protein Q13438 original sequence version: 63 DIP protein Q13438 original sequence version: 79 DIP protein Q13438-1 original sequence version: 136 65BA3F66CEC58756 tm7sf4-creb3 1 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association No figure tm7sf4-creb3-1 3 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association 1B os9-creb3 3 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Supplementary figure 1 creb3-tm7sf4 5 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component colocalization colocalization 2 and S2A tm7sf4-creb3-3 4 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 3A tm7sf4-creb3-2 4 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 29 27 physical association physical association 3B creb3-tm7sf4-2 2 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component colocalization colocalization 2 and S2A