mpidb The Microbial Protein Interaction Database RmpA regulation of capsular polysaccharide biosynthesis in Klebsiella pneumoniae CG43. RmpA regulation of capsular polysaccharide biosynthesis in Klebsiella pneumoniae CG43. J. Bacteriol. (0021-9193) 2010 imex curation Cheng H.Y., Chen Y.S., Wu C.Y., Chang H.Y., Lai Y.C., Peng H.L. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Cheng H.Y., Chen Y.S., Wu C.Y., Chang H.Y., Lai Y.C., Peng H.L. Accepted 2013-FEB-19 by ORCHARD J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation RmpA regulation of capsular polysaccharide biosynthesis in Klebsiella pneumoniae CG43. RmpA regulation of capsular polysaccharide biosynthesis in Klebsiella pneumoniae CG43. J. Bacteriol. (0021-9193) 2010 imex curation Cheng H.Y., Chen Y.S., Wu C.Y., Chang H.Y., Lai Y.C., Peng H.L. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Cheng H.Y., Chen Y.S., Wu C.Y., Chang H.Y., Lai Y.C., Peng H.L. Accepted 2013-FEB-19 by ORCHARD J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation q53343_klepn rmpA2 protein protein klepn Klebsiella pneumoniae MEKYIYFMCNKDVTLVLTDDYYFYFGLKQLTGLPLVYITYEGSMDKPIVIKQKRNIRVLVDSRIFYSGKWDGYKMLRKTLNMISQWMWLDISGGGEKFYPKGCDYDIYVNMQGNLKKNIEELYYAYLKKNVSRIGNHYPQLTKKEQIILQCLLSRREGIHELKSRLKIEEKTLSCHRCKITRKFGCKRFIRFMYLYNLNKEITDEKWCTSNT 2E1E36240FB5F0EB q8gm83_klepn Transcriptional regulatory protein RcsA SAMEA3499901_02472 rcsA BN49_3527 FXN67_15385 SAMEA3649466_00152 GNG14_09535 GTH21_13385 BANRA_03592 DDJ63_13215 SAMEA3499874_04952 SAMEA3538828_00230 SAMEA3649648_03299 SAMEA3729663_00151 protein protein klepn Klebsiella pneumoniae MSTMIMDLCSYTRLGLTGYLTSRGIKKQEIVEVNNAADLQKHCTSCCPAVVFLNEDCFVHDDESNGIIRQIITQNPATLFVIFMSLANIHFDRYLRVRKNLLISSKSITPKDLDVILVNYLKYKNTSVGQLTLPTLSLSKTESNMLQMWMAGHGTSQISTQMNIKAKTVSSHKGNIKKKIQTHNKQVIYHIVRLTENITSGIQVNMR 329B01BD6DAB3928 q8gm84_klepn Transcriptional regulatory protein RcsB G7Z27_08325 SAMEA3499901_01983 SAMEA3727679_00970 BL124_00001960 FXN67_05915 rcsB B4U61_01920 B5L96_28070 GJJ08_008205 GNG14_07495 NCTC3279_02898 DD583_07400 BN49_3854 BVX91_22705 C3F39_23625 NCTC11679_01659 NCTC13443_05291 NCTC13465_06593 NCTC204_04129 NCTC5052_03007 NCTC5053_06236 NCTC9128_06304 NCTC9140_05826 NCTC9601_00965 NCTC9617_06111 NCTC9637_02339 NCTC9645_03996 NCTC9661_02484 SAMEA4364603_01314 BANRA_03875 BS595_18845 DBX64_09270 DDJ63_09125 DRB11_01300 EHZ17_01695 BANRA_04227 BANRA_00923 GTH21_14485 SAMEA3649466_00374 G5637_11815 SAMEA3649733_01349 SAMEA3649758_00633 SAMEA3720909_00143 SAMEA3499874_02819 SAMEA3512100_01049 SAMEA3515130_01022 SAMEA3538828_02195 SAMEA3649648_00771 SAMEA3727643_01465 SAMEA3729663_00371 protein protein klepn Klebsiella pneumoniae MNTMNVIIADDHPIVLFGIRKSLEQIEWVNVVGEFEDSTALINNLPKLDAHVLITDLSMPGDKYGDGITLIKYIKRHFPDLSIIVLTMNNNPAILSAVLDLDIEGIVLKQGAPTDLPKALAALQKGKKFTPESVSRLLEKISASGYGDKRLSPKESEVLRLFAEGFLVTEIAKKLNRSIKTISSQKKSAMMKLGVENDIALLNYLSSVSLSATDKE A615B3E57E10C504 q8gm81_klepn rmpA protein protein klepn Klebsiella pneumoniae MEKYIYFICNKDVNIVLTDDYFFYYGLKQLTGLPLLHITYEGVINKSIAIKHKRNIRVLVDSRIFYSGKWGGYKMLRGSINMISQWMWLDVSGGGRFYPKGCDYDIYVNMQGNVKNNIEKLYFAFLKKNVSQVVNHYPRLTQKEQAVLQCLLKNGGINEIKSQLKIEEKTLSCYRSKITRKFGCKRYIRLMYLYSLNKEMGDERWLMPSI ED7ABC2120FE5742 rcsb-rmpa2 2 5 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Figure 4 rcsb-rmpa-1 2 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey region Q8GM81-85-210 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figure 4 rcsb-rcsa 2 4 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Figure 4 rmpa2-rcsb 1 3 unspecified role unspecified role bait bait region Q53343-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 5 unspecified role unspecified role prey prey region Q8GM84-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Figure 5B rmpa-rcsb 1 6 unspecified role unspecified role bait bait region Q8GM81-85-210 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region Q8GM81-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 5 unspecified role unspecified role prey prey region Q8GM84-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Figure 5B rcsa-rcsb 1 4 unspecified role unspecified role bait bait region Q8GM83-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 5 unspecified role unspecified role prey prey region Q8GM84-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Figure 5B