mpidb The Microbial Protein Interaction Database Dual control of Sinorhizobium meliloti RpoE2 sigma factor activity by two PhyR-type two-component response regulators. Dual control of Sinorhizobium meliloti RpoE2 sigma factor activity by two PhyR-type two-component response regulators. J. Bacteriol. (0021-9193) 2010 imex curation Bastiat B., Sauviac L., Bruand C. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight by staining molecular weight estimation by staining weight by staining Bastiat B., Sauviac L., Bruand C. Accepted 2013-FEB-18 by ORCHARD J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation Dual control of Sinorhizobium meliloti RpoE2 sigma factor activity by two PhyR-type two-component response regulators. Dual control of Sinorhizobium meliloti RpoE2 sigma factor activity by two PhyR-type two-component response regulators. J. Bacteriol. (0021-9193) 2010 imex curation Bastiat B., Sauviac L., Bruand C. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bastiat B., Sauviac L., Bruand C. Accepted 2013-FEB-18 by ORCHARD J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation Dual control of Sinorhizobium meliloti RpoE2 sigma factor activity by two PhyR-type two-component response regulators. Dual control of Sinorhizobium meliloti RpoE2 sigma factor activity by two PhyR-type two-component response regulators. J. Bacteriol. (0021-9193) 2010 imex curation Bastiat B., Sauviac L., Bruand C. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Bastiat B., Sauviac L., Bruand C. Accepted 2013-FEB-18 by ORCHARD J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation q92k05_rhime SMc01505 protein protein sinorhizobium melilo Rhizobium meliloti (strain 1021) (Ensifer meliloti) Sinorhizobium meliloti Ensifer meliloti MIGKSPSSDDPNAQIAVKLKALYQSVQEEAIPARFLDLLEKLEAAEQQSALQGKE B62FE558328734E7 q92n10_rhime SMc01504 protein protein sinorhizobium melilo Rhizobium meliloti (strain 1021) (Ensifer meliloti) Sinorhizobium meliloti Ensifer meliloti MTLSTRIAPFLPYLRRYSRALTGSQTSGDAYVAAVLEALIADTSIFPEASSDRVALFRLFTSMFGSSSVLVPEPVSPFAWEQRASVNLAAVSPLARQAFLLVSVEAFTPQEAAEVLDVDAAKLAALLDRASQEISRQVATEIMIIEDEPLIAIDIEQMVESLGHSVTGIARTKDEAIALYETTKPNMVLADIQLADGSSGIDAVNEILKTAAVPVIFITAFPERLLTGERPEPTFLVTKPFNPEMVKALISQALFFNETTKAAA B9EF019D14017C8A q92rv2_rhime SMc00794 protein protein sinorhizobium melilo Rhizobium meliloti (strain 1021) (Ensifer meliloti) Sinorhizobium meliloti Ensifer meliloti MPLSTRIAPHLPYLRRYARAVTGSQAAGDAYVAAVLEALIDDLELFPAASNDRIGLYKLFCSLFEKLKIDRTQLASPFAWEQRAASNLSLIAPPQRQAFLLVALEGFSTGEAAEIMGLDQGAFGKLLTSASEEISRQIATDVMIIEDEPLIALDIEDMVTSLGHRVTGIARTRREALNLYHQTSPKMVLADIQLADGSSGIDAVNDILTQAAVPVIFITAFPERLLTGKKPEPAFLVTKPFNPETVKALISQALFFDEHAQAGAS C5986C21E3614495 q92n11_rhime RNA polymerase sigma factor SMc01506 rpoE2 protein protein sinorhizobium melilo Rhizobium meliloti (strain 1021) (Ensifer meliloti) Sinorhizobium meliloti Ensifer meliloti MSSENQEFKREMLAALPSLRAFAMSLIGRHDRADDLVQDTIMKAWAKQDHFEIGTNMKAWLFTILRNELYSQMRKRGREVQDSDGHLTETLAHHPEQYGSLDLQDFRRALEQLPPDQREAIILVGASGFSYEEAATICGCALGTIKSRVNRARQRLQEILQVRGENDYGPDETSAPITSRAFVS 92D2557789211643 q92rv2-q92k05 2 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association table 2 q92n10-q92k05 2 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey physical association physical association table 2 q92k05-q92rv2 2 6 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association table 2 q92k05-q92n10 2 5 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association table 2 q92k05-rpoe2 2 7 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association table 2 rpoe2-q92k05 2 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association table 2 q92k05-q92rv2-1 1 4 unspecified role unspecified role bait bait q92k05-- Q92K05-- strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 6 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association figure 4 q92k05_rhime-q92n10_rhime-1 3 5 unspecified role unspecified role prey prey region Q92N10-- sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain q92n10-- Q92N10-- myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q92N10:p.Asp191Ala Q92N10-191-191 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A Wed May 02 18:48:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp191ala' Tue Jun 30 19:53:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp191Ala' ecolx Escherichia coli 4 unspecified role unspecified role bait bait q92k05-- Q92K05-- strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association figure 4 q92k05-rpoe2-1 3 4 unspecified role unspecified role bait bait q92k05-- Q92K05-- strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 7 unspecified role unspecified role prey prey q92n11-- Q92N11-- ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association figure 4A q92k05-q92n10-2 1 5 unspecified role unspecified role prey prey region Q92N10-- sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 unspecified role unspecified role bait bait region Q92K05-- strep ii tag strep ii tag Strep (II) Strep II Strep (II) Strep II undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association figure 4