UniProt UniProt http://www.uniprot.org Friend of Prmt1, a novel chromatin target of protein arginine methyltransferases. Friend of Prmt1, a novel chromatin target of protein arginine methyltransferases. Mol. Cell. Biol. (0270-7306) 2010 imex curation van Dijk T.B., Gillemans N., Stein C., Fanis P., Demmers J., van de Corput M., Essers J., Grosveld F., Bauer U.M., Philipsen S. j.philipsen@erasmusmc.nl 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions mouse-erythroleukemia Mus musculus me17-1 Murine erythroid cell line anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot van Dijk T.B., Gillemans N., Stein C., Fanis P., Demmers J., van de Corput M., Essers J., Grosveld F., Bauer U.M., Philipsen S. j.philipsen@erasmusmc.nl Accepted 2012-DEC-14 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2010 Only protein-protein interactions imex curation Friend of Prmt1, a novel chromatin target of protein arginine methyltransferases. Friend of Prmt1, a novel chromatin target of protein arginine methyltransferases. Mol. Cell. Biol. (0270-7306) 2010 imex curation van Dijk T.B., Gillemans N., Stein C., Fanis P., Demmers J., van de Corput M., Essers J., Grosveld F., Bauer U.M., Philipsen S. j.philipsen@erasmusmc.nl 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence van Dijk T.B., Gillemans N., Stein C., Fanis P., Demmers J., van de Corput M., Essers J., Grosveld F., Bauer U.M., Philipsen S. j.philipsen@erasmusmc.nl Accepted 2012-DEC-14 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2010 Only protein-protein interactions imex curation Friend of Prmt1, a novel chromatin target of protein arginine methyltransferases. Friend of Prmt1, a novel chromatin target of protein arginine methyltransferases. Mol. Cell. Biol. (0270-7306) 2010 imex curation van Dijk T.B., Gillemans N., Stein C., Fanis P., Demmers J., van de Corput M., Essers J., Grosveld F., Bauer U.M., Philipsen S. j.philipsen@erasmusmc.nl 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot van Dijk T.B., Gillemans N., Stein C., Fanis P., Demmers J., van de Corput M., Essers J., Grosveld F., Bauer U.M., Philipsen S. j.philipsen@erasmusmc.nl Accepted 2012-DEC-14 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2010 Only protein-protein interactions imex curation Friend of Prmt1, a novel chromatin target of protein arginine methyltransferases. Friend of Prmt1, a novel chromatin target of protein arginine methyltransferases. Mol. Cell. Biol. (0270-7306) 2010 imex curation van Dijk T.B., Gillemans N., Stein C., Fanis P., Demmers J., van de Corput M., Essers J., Grosveld F., Bauer U.M., Philipsen S. j.philipsen@erasmusmc.nl 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro radiolabeled methyl methyltransferase radiometric assay radiolabeled methyl autoradiography autoradiography van Dijk T.B., Gillemans N., Stein C., Fanis P., Demmers J., van de Corput M., Essers J., Grosveld F., Bauer U.M., Philipsen S. The annotations for the interaction fop-prmt1-3 seem to have disappeared and the editor does not allow me to delete and replace the interaction. j.philipsen@erasmusmc.nl Accepted 2012-DEC-14 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2010 Only protein-protein interactions imex curation Friend of Prmt1, a novel chromatin target of protein arginine methyltransferases. Friend of Prmt1, a novel chromatin target of protein arginine methyltransferases. Mol. Cell. Biol. (0270-7306) 2010 imex curation van Dijk T.B., Gillemans N., Stein C., Fanis P., Demmers J., van de Corput M., Essers J., Grosveld F., Bauer U.M., Philipsen S. j.philipsen@erasmusmc.nl 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions mouse-erythroleukemia Mus musculus me17-1 Murine erythroid cell line pull down pull down ms participant Identification by mass spectrometry ms participant van Dijk T.B., Gillemans N., Stein C., Fanis P., Demmers J., van de Corput M., Essers J., Grosveld F., Bauer U.M., Philipsen S. j.philipsen@erasmusmc.nl Accepted 2012-DEC-14 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2010 Only protein-protein interactions imex curation Friend of Prmt1, a novel chromatin target of protein arginine methyltransferases. Friend of Prmt1, a novel chromatin target of protein arginine methyltransferases. Mol. Cell. Biol. (0270-7306) 2010 imex curation van Dijk T.B., Gillemans N., Stein C., Fanis P., Demmers J., van de Corput M., Essers J., Grosveld F., Bauer U.M., Philipsen S. j.philipsen@erasmusmc.nl 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot van Dijk T.B., Gillemans N., Stein C., Fanis P., Demmers J., van de Corput M., Essers J., Grosveld F., Bauer U.M., Philipsen S. j.philipsen@erasmusmc.nl Accepted 2012-DEC-14 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2010 Only protein-protein interactions imex curation Friend of Prmt1, a novel chromatin target of protein arginine methyltransferases. Friend of Prmt1, a novel chromatin target of protein arginine methyltransferases. Mol. Cell. Biol. (0270-7306) 2010 imex curation van Dijk T.B., Gillemans N., Stein C., Fanis P., Demmers J., van de Corput M., Essers J., Grosveld F., Bauer U.M., Philipsen S. j.philipsen@erasmusmc.nl 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot van Dijk T.B., Gillemans N., Stein C., Fanis P., Demmers J., van de Corput M., Essers J., Grosveld F., Bauer U.M., Philipsen S. j.philipsen@erasmusmc.nl Accepted 2012-DEC-14 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2010 Only protein-protein interactions imex curation Friend of Prmt1, a novel chromatin target of protein arginine methyltransferases. Friend of Prmt1, a novel chromatin target of protein arginine methyltransferases. Mol. Cell. Biol. (0270-7306) 2010 imex curation van Dijk T.B., Gillemans N., Stein C., Fanis P., Demmers J., van de Corput M., Essers J., Grosveld F., Bauer U.M., Philipsen S. j.philipsen@erasmusmc.nl 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions mouse-erythroleukemia Mus musculus me17-1 Murine erythroid cell line confocal microscopy confocal microscopy immunohistochemistry immunohistochemistry van Dijk T.B., Gillemans N., Stein C., Fanis P., Demmers J., van de Corput M., Essers J., Grosveld F., Bauer U.M., Philipsen S. j.philipsen@erasmusmc.nl Accepted 2012-DEC-14 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2010 Only protein-protein interactions imex curation Friend of Prmt1, a novel chromatin target of protein arginine methyltransferases. Friend of Prmt1, a novel chromatin target of protein arginine methyltransferases. Mol. Cell. Biol. (0270-7306) 2010 imex curation van Dijk T.B., Gillemans N., Stein C., Fanis P., Demmers J., van de Corput M., Essers J., Grosveld F., Bauer U.M., Philipsen S. j.philipsen@erasmusmc.nl 18-Dec-2012: Contacted by IntAct-Help. Only protein-protein interactions mouse-erythroleukemia Mus musculus me17-1 Murine erythroid cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot van Dijk T.B., Gillemans N., Stein C., Fanis P., Demmers J., van de Corput M., Essers J., Grosveld F., Bauer U.M., Philipsen S. j.philipsen@erasmusmc.nl Accepted 2012-DEC-14 by ORCHARD 18-Dec-2012: Contacted by IntAct-Help. Mol. Cell. Biol. (0270-7306) 2010 Only protein-protein interactions imex curation ls14a_mouse Protein LSM14 homolog A Fam61a Rap55a Protein FAM61A RNA-associated protein 55A Lsm14a protein protein mouse Mus musculus Mouse MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSLGSSSSSFQSVGSYGPFGRMPAYSQFSPSTLVGQQFGAVGVAGNSLTSFGTEASNSGTLSQSNAVGSAFTQDTRSVKPQLAQGRSSPQLDPLRKSPTMEQAVQTASAHLPAPAPVGRRSPVPARPLPPTSQKAIDNQEHRRAEVHKVPRPENEQLRNDKRQVVPGVPSAPRRGRGGHRGGRGRFGIRRDGPMKFEKDFDFESANAQFNKEEIDREFHNKLKLKEDKLEKQEKPVNGEDKGDSGVDTQNSEGNADEEDPLGPNCYYDKTKSFFDNISCDDNRERRPTWAEERRLNAETFGIPLRPNRGRGGYRGRGGLGFRGGRGRGSGRGGTFTAPRGFRAGFRGARGGREFADFEYRKTTAFGP B2554A73B96C473B anm1_human Protein arginine N-methyltransferase 1 PRMT1 Interferon receptor 1-bound protein 4 Histone-arginine N-methyltransferase PRMT1 HMT2 HRMT1L2 IR1B4 protein protein human Homo sapiens Human MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR DIP protein Q99873 original sequence version: 87 DIP protein Q99873 original sequence version: 125 544349801B0E1396 chtop_mouse Chromatin target of PRMT1 protein Chtop Fop Friend of PRMT1 protein Small arginine- and glycine-rich protein MNCb-1706 protein protein mouse Mus musculus Mouse MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPMPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALKLKQKSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALTRPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND 5F3E44A53ED0645F rbmx_mouse RNA-binding motif protein, X chromosome Rbmx Hnrnpg Hnrpg Rbmxp1 Rbmxrt Heterogeneous nuclear ribonucleoprotein G protein protein mouse Mus musculus Mouse MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRGLPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDDGGYSMNFTMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGLGGRAPVSRGRDGYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSREYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY 301E02E250EDDCD3 q9cy57-2 Chromatin target of PRMT1 protein Chtop Fop Friend of PRMT1 protein Small arginine- and glycine-rich protein MNCb-1706 protein protein mouse Mus musculus Mouse MLKNKQPMPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALKLKQKSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALTRPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND May be due to an intron retention. 6D480418EFCABB24 anm1_mouse Protein arginine N-methyltransferase 1 Prmt1 Mrmt1 Hrmt1l2 Histone-arginine N-methyltransferase PRMT1 protein protein mouse Mus musculus Mouse MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLHARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLCELSCSTDYRMR AEFCF63001B1A38C alrf2_mouse Aly/REF export factor 2 Alyref2 RNA and export factor-binding protein 2 Ref2 Refbp2 Alyref protein protein mouse Mus musculus Mouse MADKMDMSLDDIIKLNRNQRRVNRGGGPRRNRPAIARGGRNRPAPYSRPKPLPDKWQHDLFDSGCGGGEGVETGAKLLVSNLDFGVSDADIQELFAEFGTLKKAAVDYDRSGRSLGTADVHFERRADALKAMKQYKGVPLDGRPMDIQLVASQIDPQRRPAQSGNRGGMTRSRGSGGFGGRGSQGRGRGTGRNSKQQQLSAEELDAQLDAYNARMDTS 977901CECDCF18FC pairb_mouse Plasminogen activator inhibitor 1 RNA-binding protein Serbp1 Pairbp1 PAI1 RNA-binding protein 1 SERPINE1 mRNA-binding protein 1 protein protein mouse Mus musculus Mouse MPGHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENKKKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQLRKESQKDRKNPLPPSVGVADKKEETQPPVALKKEGIRRVGRRPDQQLQGDGKLIDRRAERRPPRERRFEKPLEEKGEGGEFSVDRPIIERPIRGRGGLGRGRGGRGRGMGRGDGFDSRGKREFDRHSGSDRSSFSHYSGLKHEDKRGGSGSHNWGTVKDELTESPKYIQKQISYNCSDLDQSNVTEETPEGEEHPVADTENKENEVEEVKEEGPKEMTLDEWKAIQNKDRAKVEFNIRKPNEGADGQWKKGFVLHKSKSEEAHAEDSVMDHHFRKPANDITSQLEINFGDLGRPGRGGRGGRGGRGRGGRPNRGSRTDKSSASAPDVDDPEAFPALA AC4F61EF7F38A8E5 ybox3_mouse Y-box-binding protein 3 Ybx3 Cold shock domain-containing protein A Csda DNA-binding protein A Msy4 Y-box protein 3 protein protein mouse Mus musculus Mouse MSEAGEATTGGTTLPQAAADAPAAAPPDPAPKSPAASGAPQAPAPAALLAGSPGGDAAPGPAPASSAPAGGEDAEKKVLATKVLGTVKWFNVRNGYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPDGVPVEGSRYAADRRRYRRGYYGRRRGPPRNYAGEEEEEGSGSSEGFEPPAADGQFSGARNQLRRPQYRPPYRQRRFPPYHVGQTFDRRSRVFPHPNRMQAGEIGEMKDGVPEGTQLQAHRNPTYRPRFRRGPARPRPAPAIGEAEDKENQQAANGPNQPSARRGFRRPYNYRRRSRPLNAVSQDGKETKAGEAPTENPAPATEQSSAE DIP protein Q9JKB3 original sequence version: 67 5BAF6A144A127CEC hnrpu_mouse Heterogeneous nuclear ribonucleoprotein U Hnrpu Hnrnpu Scaffold-attachment factor A protein protein mouse Mus musculus Mouse MSSSPVNVKKLKVSELKEELKKRRLSDKGLKADLMDRLQAALDNEAGGRPAMEPGNGSLDLGGDAAGRSGAGLEQEAAAGAEDDEEEEGIAALDGDQMELGEENGAAGAADAGAMEEEEAASEDENGDDQGFQEGEDELGDEEEGAGDENGHGEQQSQPPAAAAQQQPSQQRGAGKEAAGKSSGPTSLFAVTVAPPGARQGQQQAGGDGKTEQKGGDKKRGVKRPREDHGRGYFEYIEENKYSRAKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFKISRDRLSASSLTMESFAFLWAGGRASYGVSKGKVCFEMKVTEKIPVRHLYTKDIDIHEVRIGWSLTTSGMLLGEEEFSYGYSLKGIKTCNCETEDYGEKFDENDVITCFANFETDEVELSYAKNGQDLGVAFKISKEVLADRPLFPHVLCHNCAVEFNFGQKEKPYFPIPEDCTFIQNVPLEDRVRGPKGPEEKKDCEVVMMIGLPGAGKTTWVTKHAAENPGKYNILGTNTIMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQTNVSAAAQRRKMCLFAGFQRKAVVVCPKDEDYKQRTQKKAEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGGNFRGGAPGNRGGYNRRGNMPQRGGGGGSGGIGYPYPRGPVFPGRGGYSNRGNYNRGGMPNRGNYNQNFRGRGNNRGYKNQSQGYNQWQQGQFWGQKPWSQHYHQGYY 2BA7C73043F847B2 chtop_human Chromatin target of PRMT1 protein HT031 PP7704 FOP CHTOP C1orf77 Friend of PRMT1 protein Small arginine- and glycine-rich protein protein protein human Homo sapiens Human MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPTPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALKLKQSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND 3D97D16610FCE0E6 nop56_mouse Nucleolar protein 56 Nop56 Nol5a Nucleolar protein 5A protein protein mouse Mus musculus Mouse MVLLHVLFEHAVGYALLALKEVEEISLLLPQVEECVLNLGKFHNVVRLVAFCPFSSSQVALENANAVSEGVVHEDLRLLLETYLPSKKKKVLLGVGDPKIGAAIQEELGYNCQTGGVIAEILRGVRLHFHNLVKGLTDLSACKAQLGLGHSYSRAKVKFNVNRVDNMIIQSISLLDQLDKDINTFSMRVREWYGYHFPELVKIVNDNATYCRLAQFIGNRRELNEEKLEKLEEITMDGAKAKAILDASRSSMGMDISAIDLINIESFSSRVVSLSEYRQSLHTYLRSKMSQVAPSLSALIGEAVGARLIAHAGSLTNLAKYPASTVQILGAEKALFRALKTRGNTPKYGLIFHSTFIGRAAAKNKGRISRYLANKCSIASRIDCFSEVPTSVFGEKLREQVEERLSFYETGEIPRKNLDVMKEAVVQAEEAAAEITRKLEKQEKKRLKKEKKRLAALALASSENSSTPEECEEVNEKSKKKKKLKPQENGMEDPPVSLPKSKKKKAPKEELASDLEEMATSSAKRKKSSPKEEVASEPEEAASPTTPKKKRKFSEEPEVAANFTKSSTKKKKKSQKAQED 60AA1D43E349ADD7 anm5_mouse Protein arginine N-methyltransferase 5 Prmt5 Jbp1 Skb1 Histone-arginine N-methyltransferase PRMT5 Shk1 kinase-binding protein 1 homolog Jak-binding protein 1 protein protein mouse Mus musculus Mouse MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIHPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDVIANAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKVQQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKETNVQVLMVLGAGRGPLVNASLRAAKQAERRIRLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPKPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYRDITLSIRPETHSPGMFSWFPIFFPIKQPITVHEGQNICVRFWRCSNSKKVWYEWAVTAPVCSSIHNPTGRSYTIGL E8014CA172B30543 q9cy57-1 Chromatin target of PRMT1 protein Chtop Fop Friend of PRMT1 protein Small arginine- and glycine-rich protein MNCb-1706 protein protein mouse Mus musculus Mouse MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPMPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALKLKQKSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALTRPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND 5F3E44A53ED0645F prmt1-fop 5 15 unspecified role unspecified role bait bait n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus biotin tag biotin tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role prey prey 13 unspecified role unspecified role prey prey 16 unspecified role unspecified role prey prey 21 unspecified role unspecified role prey prey 17 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 18 unspecified role unspecified role prey prey 19 unspecified role unspecified role prey prey association association Fig. 1C fop-prmt1 6 12 unspecified role unspecified role bait bait n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Figs. 3A fop-prmt1-2 3 12 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 15 unspecified role unspecified role prey prey mouse-erythroleukemia Mus musculus me17-1 Murine erythroid cell line physical association physical association Fig. 3C fop-prmt5 4 22 enzyme enzyme unspecified role unspecified role 12 enzyme target enzyme target substrate substrate unspecified role unspecified role n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) methylation methylation reaction methylation Fig. 4B Chtop is symmetrically dimethylated on some arginines. fop-prmt1-4 9 22 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait 15 unspecified role unspecified role prey prey association association Fig. 4C fop-prmt1-5 1 22 unspecified role unspecified role prey prey 15 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range range required to bind necessary binding region required to bind western blot western blot Immuno blot Immuno blot certain certain sequence position certain certain certain sequence position certain association association Fig. 4D fop-prmt1-10 8 12 unspecified role unspecified role neutral component neutral component n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 5A fop-prmt1-11 2 12 unspecified role unspecified role neutral component neutral component n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 15 unspecified role unspecified role neutral component neutral component n-terminus mcherry mcherry fluorescent protein tag mcherry n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Fig. 5C chtop-prmt1 7 11 unspecified role unspecified role prey prey 20 unspecified role unspecified role bait bait physical association physical association Fig. 3B prmt1-chtop 7 20 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association Fig. 3B fop-prmt1-8 3 15 unspecified role unspecified role prey prey mouse-erythroleukemia Mus musculus me17-1 Murine erythroid cell line 23 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 3C fop-prmt1-9 3 15 unspecified role unspecified role prey prey mouse-erythroleukemia Mus musculus me17-1 Murine erythroid cell line 14 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association Fig. 3C fop-prmt1-12 9 15 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait physical association physical association Fig. 4C fop-prmt5-2 9 12 unspecified role unspecified role bait bait 22 unspecified role unspecified role prey prey physical association physical association Fig. 4C