mpidb The Microbial Protein Interaction Database Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. J. Bacteriol. (0021-9193) 2010 imex curation Callahan B., Nguyen K., Collins A., Valdes K., Caplow M., Crossman D.K., Steyn A.J., Eisele L., Derbyshire K.M. Only protein-protein interactions ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Callahan B., Nguyen K., Collins A., Valdes K., Caplow M., Crossman D.K., Steyn A.J., Eisele L., Derbyshire K.M. Accepted 2013-FEB-15 by ORCHARD J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. J. Bacteriol. (0021-9193) 2010 imex curation Callahan B., Nguyen K., Collins A., Valdes K., Caplow M., Crossman D.K., Steyn A.J., Eisele L., Derbyshire K.M. Only protein-protein interactions ecolx Escherichia coli cd circular dichroism CD CD cd predetermined predetermined participant predetermined Callahan B., Nguyen K., Collins A., Valdes K., Caplow M., Crossman D.K., Steyn A.J., Eisele L., Derbyshire K.M. Accepted 2013-FEB-15 by ORCHARD J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. J. Bacteriol. (0021-9193) 2010 imex curation Callahan B., Nguyen K., Collins A., Valdes K., Caplow M., Crossman D.K., Steyn A.J., Eisele L., Derbyshire K.M. Only protein-protein interactions ecolx Escherichia coli light scattering light scattering predetermined predetermined participant predetermined Callahan B., Nguyen K., Collins A., Valdes K., Caplow M., Crossman D.K., Steyn A.J., Eisele L., Derbyshire K.M. Accepted 2013-FEB-15 by ORCHARD J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. J. Bacteriol. (0021-9193) 2010 imex curation Callahan B., Nguyen K., Collins A., Valdes K., Caplow M., Crossman D.K., Steyn A.J., Eisele L., Derbyshire K.M. Only protein-protein interactions mycsm Mycobacterium smegmatis dhfr reconstruction dihydrofolate reductase reconstruction dhfr reconstruction predetermined predetermined participant predetermined Callahan B., Nguyen K., Collins A., Valdes K., Caplow M., Crossman D.K., Steyn A.J., Eisele L., Derbyshire K.M. Accepted 2013-FEB-15 by ORCHARD J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. Conservation of structure and protein-protein interactions mediated by the secreted mycobacterial proteins EsxA, EsxB, and EspA. J. Bacteriol. (0021-9193) 2010 imex curation Callahan B., Nguyen K., Collins A., Valdes K., Caplow M., Crossman D.K., Steyn A.J., Eisele L., Derbyshire K.M. Only protein-protein interactions mycsm Mycobacterium smegmatis dhfr reconstruction dihydrofolate reductase reconstruction dhfr reconstruction nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Callahan B., Nguyen K., Collins A., Valdes K., Caplow M., Crossman D.K., Steyn A.J., Eisele L., Derbyshire K.M. Accepted 2013-FEB-15 by ORCHARD J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation ecc1a_myctu ESX-1 secretion system protein EccCa1 eccCa1 snm1 ESX conserved component Ca1 Type VII secretion system protein EccCa1 Rv3870 Snm1 secretory protein protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTTKKFTPTITRGPRLTPGEISLTPPDDLGIDIPPSGVQKILPYVMGGAMLGMIAIMVAGGTRQLSPYMLMMPLMMIVMMVGGLAGSTGGGGKKVPEINADRKEYLRYLAGLRTRVTSSATSQVAFFSYHAPHPEDLLSIVGTQRQWSRPANADFYAATRIGIGDQPAVDRLLKPAVGGELAAASAAPQPFLEPVSHMWVVKFLRTHGLIHDCPKLLQLRTFPTIAIGGDLAGAAGLMTAMICHLAVFHPPDLLQIRVLTEEPDDPDWSWLKWLPHVQHQTETDAAGSTRLIFTRQEGLSDLAARGPHAPDSLPGGPYVVVVDLTGGKAGFPPDGRAGVTVITLGNHRGSAYRIRVHEDGTADDRLPNQSFRQVTSVTDRMSPQQASRIARKLAGWSITGTILDKTSRVQKKVATDWHQLVGAQSVEEITPSRWRMYTDTDRDRLKIPFGHELKTGNVMYLDIKEGAEFGAGPHGMLIGTTGSGKSEFLRTLILSLVAMTHPDQVNLLLTDFKGGSTFLGMEKLPHTAAVVTNMAEEAELVSRMGEVLTGELDRRQSILRQAGMKVGAAGALSGVAEYEKYRERGADLPPLPTLFVVVDEFAELLQSHPDFIGLFDRICRVGRSLRVHLLLATQSLQTGGVRIDKLEPNLTYRIALRTTSSHESKAVIGTPEAQYITNKESGVGFLRVGMEDPVKFSTFYISGPYMPPAAGVETNGEAGGPGQQTTRQAARIHRFTAAPVLEEAPTP CF6AA9153BE6F41E esxb_myctu ESAT-6-like protein EsxB esxB cfp10 lhp mtsA10 Rv3874 MTV027.09 10 kDa culture filtrate antigen CFP-10 Secreted antigenic protein MTSA-10 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MAEMKTDAATLAQEAGNFERISGDLKTQIDQVESTAGSLQGQWRGAAGTAAQAAVVRFQEAANKQKQELDEISTNIRQAGVQYSRADEEQQQALSSQMGF DIP protein P9WNK5 original sequence version: 8 DIP protein P9WNK5 original sequence version: 10 285F4FC96F55D194 espa_myctu ESX-1 secretion-associated protein EspA espA Rv3616c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSRAFIIDPTISAIDGLYDLLGIGIPNQGGILYSSLEYFEKALEELAAAFPGDGWLGSAADKYAGKNRNHVNFFQELADLDRQLISLIHDQANAVQTTRDILEGAKKGLEFVRPVAVDLTYIPVVGHALSAAFQAPFCAGAMAVVGGALAYLVVKTLINATQLLKLLAKLAELVAAAIADIISDVADIIKGTLGEVWEFITNALNGLKELWDKLTGWVTGLFSRGWSNLESFFAGVPGLTGATSGLSQVTGLFGAAGLSASSGLAHADSLASSASLPALAGIGGGSGFGGLPSLAQVHAASTRQALRPRADGPVGAAAEQVGGQSQLVSAQGSQGMGGPVGMGGMHPSSGASKGTTTKKYSEGAAAGTEDAERAPVEADAGGGQKVLVRNVV 82BBA8DD99D6F567 esxa_myctu 6 kDa early secretory antigenic target esxA esaT6 Rv3875 MTV027.10 ESAT-6 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTEQQWNFAGIEAAASAIQGNVTSIHSLLDEGKQSLTKLAAAWGGSGSEAYQGVQQKWDATATELNNALQNLARTISEAGQAMASTEGNVTGMFA DIP protein P9WNK7 original sequence version: 8 DIP protein P9WNK7 original sequence version: 10 79BD529E3D88F519 eccb1_myctu ESX-1 secretion system ATPase EccB1 eccB1 ESX conserved component B1 Type VII secretion system protein EccB1 Rv3869 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MGLRLTTKVQVSGWRFLLRRLEHAIVRRDTRMFDDPLQFYSRSIALGIVVAVLILAGAALLAYFKPQGKLGGTSLFTDRATNQLYVLLSGQLHPVYNLTSARLVLGNPANPATVKSSELSKLPMGQTVGIPGAPYATPVSAGSTSIWTLCDTVARADSTSPVVQTAVIAMPLEIDASIDPLQSHEAVLVSYQGETWIVTTKGRHAIDLTDRALTSSMGIPVTARPTPISEGMFNALPDMGPWQLPPIPAAGAPNSLGLPDDLVIGSVFQIHTDKGPQYYVVLPDGIAQVNATTAAALRATQAHGLVAPPAMVPSLVVRIAERVYPSPLPDEPLKIVSRPQDPALCWSWQRSAGDQSPQSTVLSGRHLPISPSAMNMGIKQIHGTATVYLDGGKFVALQSPDPRYTESMYYIDPQGVRYGVPNAETAKSLGLSSPQNAPWEIVRLLVDGPVLSKDAALLEHDTLPADPSPRKVPAGASGAP D19CAD0FB2B9DE4A espj_myctu ESX-1 secretion-associated protein EspJ espJ TB27.4 Rv3878 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MAEPLAVDPTGLSAAAAKLAGLVFPQPPAPIAVSGTDSVVAAINETMPSIESLVSDGLPGVKAALTRTASNMNAAADVYAKTDQSLGTSLSQYAFGSSGEGLAGVASVGGQPSQATQLLSTPVSQVTTQLGETAAELAPRVVATVPQLVQLAPHAVQMSQNASPIAQTISQTAQQAAQSAQGGSGPMPAQLASAEKPATEQAEPVHEVTNDDQGDQGDVQPAEVVAAARDEGAGASPGQQPGGGVPAQAMDTGAGARPAASPLAAPVDPSTPAPSTTTTL 70B209E9EE7CADB5 esxg_myctu ESAT-6-like protein EsxG Conserved protein TB9.8 LH57_01570 Rv0287 esxG protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF 927527DA610A1637 ecc1b_myctu ESX-1 secretion system protein EccCb1 eccCb1 snm2 ESX conserved component Cb1 Type VII secretion system protein EccCb1 Rv3871 Snm2 secretory protein protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MTAEPEVRTLREVVLDQLGTAESRAYKMWLPPLTNPVPLNELIARDRRQPLRFALGIMDEPRRHLQDVWGVDVSGAGGNIGIGGAPQTGKSTLLQTMVMSAAATHSPRNVQFYCIDLGGGGLIYLENLPHVGGVANRSEPDKVNRVVAEMQAVMRQRETTFKEHRVGSIGMYRQLRDDPSQPVASDPYGDVFLIIDGWPGFVGEFPDLEGQVQDLAAQGLAFGVHVIISTPRWTELKSRVRDYLGTKIEFRLGDVNETQIDRITREIPANRPGRAVSMEKHHLMIGVPRFDGVHSADNLVEAITAGVTQIASQHTEQAPPVRVLPERIHLHELDPNPPGPESDYRTRWEIPIGLRETDLTPAHCHMHTNPHLLIFGAAKSGKTTIAHAIARAICARNSPQQVRFMLADYRSGLLDAVPDTHLLGAGAINRNSASLDEAVQALAVNLKKRLPPTDLTTAQLRSRSWWSGFDVVLLVDDWHMIVGAAGGMPPMAPLAPLLPAAADIGLHIIVTCQMSQAYKATMDKFVGAAFGSGAPTMFLSGEKQEFPSSEFKVKRRPPGQAFLVSPDGKEVIQAPYIEPPEEVFAAPPSAG 7CD309E881A9739D espi_myctu ESX-1 secretion-associated protein EspI espI Rv3876 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MAADYDKLFRPHEGMEAPDDMAAQPFFDPSASFPPAPASANLPKPNGQTPPPTSDDLSERFVSAPPPPPPPPPPPPPTPMPIAAGEPPSPEPAASKPPTPPMPIAGPEPAPPKPPTPPMPIAGPEPAPPKPPTPPMPIAGPAPTPTESQLAPPRPPTPQTPTGAPQQPESPAPHVPSHGPHQPRRTAPAPPWAKMPIGEPPPAPSRPSASPAEPPTRPAPQHSRRARRGHRYRTDTERNVGKVATGPSIQARLRAEEASGAQLAPGTEPSPAPLGQPRSYLAPPTRPAPTEPPPSPSPQRNSGRRAERRVHPDLAAQHAAAQPDSITAATTGGRRRKRAAPDLDATQKSLRPAAKGPKVKKVKPQKPKATKPPKVVSQRGWRHWVHALTRINLGLSPDEKYELDLHARVRRNPRGSYQIAVVGLKGGAGKTTLTAALGSTLAQVRADRILALDADPGAGNLADRVGRQSGATIADVLAEKELSHYNDIRAHTSVNAVNLEVLPAPEYSSAQRALSDADWHFIADPASRFYNLVLADCGAGFFDPLTRGVLSTVSGVVVVASVSIDGAQQASVALDWLRNNGYQDLASRACVVINHIMPGEPNVAVKDLVRHFEQQVQPGRVVVMPWDRHIAAGTEISLDLLDPIYKRKVLELAAALSDDFERAGRR 752E072FB8B10111 esxh_myctu ESAT-6-like protein EsxH 10 kDa antigen CFP7 Low molecular weight protein antigen 7 Protein TB10.4 MTV035.16 Rv0288 esxH cfp7 protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG EC47BE7E10690437 esxa-esxb-5 2 9 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association 3D esxg-esxh-3 2 15 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component physical association physical association 3D esxg-esxh-2 1 15 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component physical association physical association 3F esxg-esxh-4 3 15 unspecified role unspecified role neutral component neutral component 12 unspecified role unspecified role neutral component neutral component physical association physical association 3E, Table 1 esxa-esxb-6 3 9 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 esxa-esxb-7 1 7 unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component physical association physical association Table 1 esxb-espa 4 9 unspecified role unspecified role ancillary ancillary 7 unspecified role unspecified role bait bait P9WNK5:p.Gln42Pro mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain Q P Wed May 02 15:35:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln42pro' Tue Jun 30 19:10:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln42Pro' 8 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Figs. 4A, 5 esxb-eccb1 5 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role ancillary ancillary 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 esxb-eccca1 5 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role ancillary ancillary 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 esxb-eccca1-1 5 7 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 esxb-ecccb1 4 13 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait P9WNK5:p.Gln42Pro mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Q P Wed May 02 14:52:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln42pro' Tue Jun 30 17:39:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln42Pro' 9 unspecified role unspecified role ancillary ancillary physical association physical association Fig. 5 esxb-ecccb1-1 5 7 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 esxb-esxb 5 7 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 esxb-esxa 5 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 esxb-espi 5 9 unspecified role unspecified role ancillary ancillary 14 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait physical association physical association Table 2 esxb-espi-1 5 7 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 esxb-espj 5 9 unspecified role unspecified role ancillary ancillary 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait physical association physical association Table 2 esxb-espj-1 5 7 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 esxb-ecccb1-2 5 9 unspecified role unspecified role ancillary ancillary 7 unspecified role unspecified role bait bait 13 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Table 2 esxb-espj-2 5 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role ancillary ancillary physical association physical association Table 2