mpidb The Microbial Protein Interaction Database Functional characterization of SsaE, a novel chaperone protein of the type III secretion system encoded by Salmonella pathogenicity island 2. Functional characterization of SsaE, a novel chaperone protein of the type III secretion system encoded by Salmonella pathogenicity island 2. J. Bacteriol. (0021-9193) 2009 imex curation Miki T., Shibagaki Y., Danbara H., Okada N. Only protein-protein interactions salts Salmonella typhimurium (strain SL1344) anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Miki T., Shibagaki Y., Danbara H., Okada N. Accepted 2013-FEB-14 by ORCHARD J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation Functional characterization of SsaE, a novel chaperone protein of the type III secretion system encoded by Salmonella pathogenicity island 2. Functional characterization of SsaE, a novel chaperone protein of the type III secretion system encoded by Salmonella pathogenicity island 2. J. Bacteriol. (0021-9193) 2009 imex curation Miki T., Shibagaki Y., Danbara H., Okada N. Only protein-protein interactions salts Salmonella typhimurium (strain SL1344) anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Miki T., Shibagaki Y., Danbara H., Okada N. Accepted 2013-FEB-14 by ORCHARD J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation Functional characterization of SsaE, a novel chaperone protein of the type III secretion system encoded by Salmonella pathogenicity island 2. Functional characterization of SsaE, a novel chaperone protein of the type III secretion system encoded by Salmonella pathogenicity island 2. J. Bacteriol. (0021-9193) 2009 imex curation Miki T., Shibagaki Y., Danbara H., Okada N. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Miki T., Shibagaki Y., Danbara H., Okada N. Accepted 2013-FEB-14 by ORCHARD J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation Functional characterization of SsaE, a novel chaperone protein of the type III secretion system encoded by Salmonella pathogenicity island 2. Functional characterization of SsaE, a novel chaperone protein of the type III secretion system encoded by Salmonella pathogenicity island 2. J. Bacteriol. (0021-9193) 2009 imex curation Miki T., Shibagaki Y., Danbara H., Okada N. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Miki T., Shibagaki Y., Danbara H., Okada N. Accepted 2013-FEB-14 by ORCHARD J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation a0a0h3nke9_salts Sulfurtransferase sseA G1W50_19345 G1W53_19225 G1W54_19815 G1W55_21820 G1W56_19690 G1W57_21235 G1W62_20300 G1W63_19490 G1W64_19520 G1W66_20695 G1W67_19875 G1W69_20665 G1W71_21665 G1W74_21240 G1W86_18200 G1W87_19140 G1W89_18985 G1W92_18890 G1W99_19710 G1X03_18850 G1X04_08615 G1X06_20335 G1X09_19835 G1X10_19745 G1X13_19825 G1X15_13285 G1X17_20625 G1X19_12455 G1X23_19220 G1X27_11165 G1X29_19535 G1X32_19785 G1X35_19485 G1X38_20080 G1X42_18895 G1X44_19110 G1X47_19510 G1X49_18855 G1X50_20045 G1X51_19835 G1X52_19525 G1X54_21390 G1X57_18100 G1X61_20300 G1X64_20055 G1X66_19200 G1X67_20045 G1X68_16555 G1X69_20105 G1X71_19840 G1X75_21855 G1X76_19495 G1X77_21830 G1X80_18335 G1X84_18890 G1X85_19650 G1X86_19825 G1X87_20340 G1X94_19345 G1X96_19830 G1X99_19525 G1Y02_19525 G1Y04_20040 G1Y11_19220 SL1344_2495 protein protein salts Salmonella typhimurium (strain SL1344) MTTAFFVAADWLAEHIDDPEIQILDARMAPPGQEHRDMAGEYRAGHIPGALFFDIEALSDRASPLPHMMPRPEAFAVAMRELGVRQDKHLVIYDEGNLFSAPRAWWMLRTFGAEKVSILAGGLAGWQRDEWLLREGEEAHEGGEFEAKFAPQAVVRLTDVLLASHEKTAQIVDARPAARFNAQADEPRPGLRRGHIPGALNVPWTELVYEGELKTTDELNEVFFSHGVSFDRPIIASCGSGVTAAVVVLALATLDVPDVTLYDGAWSEWGARTDLPVEPA 2A58A85BDDCF0CCB a0a0h3nb70_salts sseC G1W50_11020 G1W92_07465 G1X04_02030 G1X42_07465 SL1344_1334 protein protein salts Salmonella typhimurium (strain SL1344) MNRIHSNSDSAAGVTALTHHHLSNVSCVSSGSLGKRQHRVNSTFGDGNAACLLSGKISLQEASNALKQLLDAVPGNHKRPSLPDFLQTNPAVLSMMMTSLILNVFGNNAQSLCQQLERATEVQNALRNKQVKEYQEQIQKAIEQEDKARKAGIFGAIFDWITGIFETVIGALKVVEGFLSGNPAEMASGVAYMAAGCAGMVKAGAETAMMCGADHDTCQAIIDVTSKIQFGCEAVALALDVFQIGRAFMATRGLSGAAAKVLDSGFGEEVVERMVGAGEAEIEELAEKFGEEVSESFSKQFEPLEREMAMANEMAEEAAEFSRNVENNMTRSAGKSFTKEGVKAMAKEAAKEALEKCVQEGGKFLLKKFRNKVLFNMFKKILYALLRDCSFKGLQAIRCATEGASQMNTGMVNTEKAKIEKKIEQLITQQRFLDFIMQQTENQKKIEQKRLEELYKGSGAALRDVLDTIDHYSSVQARIAGYRA 14C40E43A0699285 a0a0h3nkw8_salts ssaK G1W50_10965 G1W53_02190 G1W54_02190 G1W56_05545 G1W62_10385 G1W63_02190 G1W64_07950 G1W67_10380 G1W86_01870 G1W87_09705 G1W89_04975 G1W92_07410 G1X03_02190 G1X04_01975 G1X09_05285 G1X10_02190 G1X13_05285 G1X17_05285 G1X23_02175 G1X29_05285 G1X32_04870 G1X38_02190 G1X42_07410 G1X44_10130 G1X47_04855 G1X49_02190 G1X50_07410 G1X51_05285 G1X52_07955 G1X57_16270 G1X61_10390 G1X64_10135 G1X66_02190 G1X67_10135 G1X68_02190 G1X69_05550 G1X71_05290 G1X76_02190 G1X80_02190 G1X84_04875 G1X85_02190 G1X86_07635 G1X87_07430 G1X94_04855 G1X96_07640 G1X99_07965 G1Y02_04875 G1Y04_10125 G1Y11_08295 SL1344_1345 protein protein salts Salmonella typhimurium (strain SL1344) MSFTSLPLTEINHKLPARNIIESQWITLQLTLFAQEQQAKRVSHAIVSSAYRKAEKIIRDAYRYQREQKVEQQQELACLRKNTLEKMEVEWLEQHVKHLQDDENQFRSLVDHAAHHIKNSIEQVLLAWFDQQSVDSVMCHRLARQATAMAEEGALYLRIHPEKEALMRETFGKRFTLIIEPGFSPDQAELSSTRYAVEFSLSRHFNALLKWLRNGEDKRGSDEY 533A24B4840302BC a0a0h3nkv4_salts ssaE G1W50_16300 G1W53_02265 G1W54_02265 G1W55_00595 G1W56_05620 G1W57_00235 G1W62_10460 G1W63_02265 G1W64_08025 G1W66_00595 G1W67_10455 G1W69_00595 G1W71_00595 G1W74_00235 G1W86_01945 G1W87_16715 G1W89_05050 G1W92_07485 G1W99_00750 G1X03_02265 G1X04_10430 G1X06_11885 G1X09_05360 G1X10_02265 G1X13_05360 G1X15_02530 G1X17_05360 G1X19_09305 G1X23_02250 G1X27_05350 G1X29_05360 G1X32_04945 G1X35_13135 G1X38_02265 G1X41_01880 G1X42_07485 G1X44_10205 G1X47_04930 G1X49_02265 G1X50_07485 G1X51_05360 G1X52_08030 G1X54_00595 G1X57_15425 G1X61_10465 G1X64_10210 G1X66_02265 G1X67_10210 G1X68_02265 G1X69_05625 G1X71_05365 G1X75_00595 G1X76_02265 G1X77_00595 G1X80_02265 G1X84_04950 G1X85_02265 G1X86_16775 G1X87_07505 G1X94_04930 G1X96_16780 G1X99_08040 G1Y02_04950 G1Y04_10200 G1Y11_08370 SL1344_1330 protein protein salts Salmonella typhimurium (strain SL1344) MTTLTRLEDLLLHSREEAKGIILQLRAARKQLEENNGKLQDPQQYQQNTLLLEAIEQAENIINIIYYRYHNSALVVSEQE C2FC662414A04678 a0a0h3npr5_salts sseBb SL1344_2497 protein protein salts Salmonella typhimurium (strain SL1344) MSETKNELEILLEKAATEPAHRPAFFRTLLESTVWVPGSAAEGEAIVEDSALDLQHWEKEDGTTVIPFFTSLEALQQAVEDEQAFVVMPARTLFEMTLGETLFLNAKLPTGKEFMPREISLLLAEEGSPLSTQEVLEGGESLILSEVAEPPSQMIDSLTTLFKTIKPVKRAFLCAIKEHADAQPNLLIGIEADGEIEEIIHAAGNVATDTLPGDEPIDICQVRKGEQGISHFITEHIAPFYERRWGGFLRDFKQNRII 8B8ED83F236AEC54 a0a0h3nb84_salts Protein-secreting ATPase ssaN G1W50_10945 G1W53_02170 G1W54_02170 G1W56_05525 G1W62_10365 G1W63_02170 G1W64_07930 G1W67_10360 G1W86_01850 G1W87_09685 G1W89_04955 G1W92_07390 G1X03_02170 G1X04_01955 G1X09_05265 G1X10_02170 G1X13_05265 G1X17_05265 G1X23_02155 G1X29_05265 G1X32_04850 G1X38_02170 G1X42_07390 G1X44_10110 G1X47_04835 G1X49_02170 G1X50_07390 G1X51_05265 G1X52_07935 G1X57_16250 G1X61_10370 G1X64_10115 G1X66_02170 G1X67_10115 G1X68_02170 G1X69_05530 G1X71_05270 G1X76_02170 G1X80_02170 G1X84_04855 G1X85_02170 G1X86_07615 G1X87_07410 G1X94_04835 G1X96_07620 G1X99_07945 G1Y02_04855 G1Y04_10105 G1Y11_08275 SL1344_1349 protein protein salts Salmonella typhimurium (strain SL1344) MKNELMQRLRLKYPPPDGYCRWGRIQDVSATLLNAWLPGVFMGELCCIKPGEELAEVVGINGSKALLSPFTSTIGLHCGQQVMALRRRHQVPVGEALLGRVIDGFGRPLDGRELPDVCWKDYDAMPPPAMVRQPITQPLMTGIRAIDSVATCGEGQRVGIFSAPGVGKSTLLAMLCNAPDADSNVLVLIGERGREVREFIDFTLSEETRKRCVIVVATSDRPALERVRALFVATTIAEFFRDNGKRVVLLADSLTRYARAAREIALAAGETAVSGEYPPGVFSALPRLLERTGMGEKGSITAFYTVLVEGDDMNEPLADEVRSLLDGHIVLSRRLAERGHYPAIDVLATLSRVFPVVTSHEHRQLAAILRRCLALYQEVELLIRIGEYQRGVDTDTDKAIDTYPDICTFLRQSKDEVCGPELLIEKLHQILTE 8EE0E5FCB41EA455 a0a0h3nb13_salts ssaQ G1W50_10930 G1W53_02155 G1W54_02155 G1W56_05510 G1W62_10350 G1W63_02155 G1W64_07915 G1W67_10345 G1W86_01835 G1W87_09670 G1W89_04940 G1W92_07375 G1X03_02155 G1X04_01940 G1X09_05250 G1X10_02155 G1X13_05250 G1X17_05250 G1X23_02140 G1X29_05250 G1X32_04835 G1X38_02155 G1X42_07375 G1X44_10095 G1X47_04820 G1X49_02155 G1X50_07375 G1X51_05250 G1X52_07920 G1X57_16235 G1X61_10355 G1X64_10100 G1X66_02155 G1X67_10100 G1X68_02155 G1X69_05515 G1X71_05255 G1X76_02155 G1X80_02155 G1X84_04840 G1X85_02155 G1X86_07600 G1X87_07395 G1X94_04820 G1X96_07605 G1X99_07930 G1Y02_04840 G1Y04_10090 G1Y11_08260 SL1344_1352 protein protein salts Salmonella typhimurium (strain SL1344) MLRIANEERPWVEILPTQGATIGELTLSMQQYPVQQGTLFTINYHNELGRVWIAEQCWQRWCEGLIGTANRSAIDPELLYGIAEWGLAPLLQASDATLCQNEPPTSCSNLPHQLALHIKWTVEEHEFHSIIFTWPTGFLRNIVGELSAERQQIYPAPPVVVPVYSGWCQLTLIELESIEIGMGVRIHCFGDIRLGFFAIQLPGGIYARVLLTEDNTMKFDELVQDIETLLASGSPMSKSDGTSSVELEQIPQQVLFEVGRASLEIGQLRQLKTGDVLPVGGCFAPEVTIRVNDRIIGQGELIACGNEFMVRITRWYLCKNTA F1A0BC9AE2F2C5AE a0a0h3ncq8_salts ssaH SL1344_1341 protein protein salts Salmonella typhimurium (strain SL1344) MFAGVNHSLISQVHAMLPALTVIVPDKKLQLVCLALLLAGLNEPLKAAKILSDIDLPEAMALRLLFPAPNEGFEN AFE94DAC5F2B2BBA ssae-ssah-4 2 8 unspecified role unspecified role bait bait region E1WFR2-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey association association in text ssebb-ssae 3 9 unspecified role unspecified role bait bait region E1WJ11-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 8 unspecified role unspecified role prey prey region E1WFR2-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association figure 4 ssae-ssebb-1 1 8 unspecified role unspecified role bait bait region E1WFR2-52-68 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region E1WFR2-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey physical association physical association figures 4A, 4B, 5 ssae-ssan-1 4 10 unspecified role unspecified role prey prey region E1WFT1-- ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 8 unspecified role unspecified role bait bait region E1WFR2-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A0A0H3NKV4:p.Ile55Gly E1WFR2-55-55 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain I G Wed May 02 17:11:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile55gly' Tue Jun 30 16:42:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile55Gly' ecolx Escherichia coli physical association physical association figure 7