mpidb The Microbial Protein Interaction Database ZipN, an FtsA-like orchestrator of divisome assembly in the model cyanobacterium Synechocystis PCC6803. ZipN, an FtsA-like orchestrator of divisome assembly in the model cyanobacterium Synechocystis PCC6803. Mol. Microbiol. (0950-382X) 2009 imex curation Marbouty M., Saguez C., Cassier-Chauvat C., Chauvat F. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Marbouty M., Saguez C., Cassier-Chauvat C., Chauvat F. Accepted 2013-FEB-10 by ORCHARD Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation ZipN, an FtsA-like orchestrator of divisome assembly in the model cyanobacterium Synechocystis PCC6803. ZipN, an FtsA-like orchestrator of divisome assembly in the model cyanobacterium Synechocystis PCC6803. Mol. Microbiol. (0950-382X) 2009 imex curation Marbouty M., Saguez C., Cassier-Chauvat C., Chauvat F. Only protein-protein interactions ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Marbouty M., Saguez C., Cassier-Chauvat C., Chauvat F. Accepted 2013-FEB-10 by ORCHARD Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation sepf_syny3 Cell division protein SepF sepF slr2073 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MILTKLKDFVGISEHDEYEEDYDEEMEFPQSVASQPPAEEVAPPPRISREPLSLNNETSIGTGVRNNVIGMPGINNSVAEVVVVEPHSFDEMPQVIQTLRERKSVVLNLNVMDPEEAQRAVDFVAGGTFAMDGHQERIGESIFLFTPNCVKVSSLAGRSQESNETSSSVSSDNFPTWGYETSRLAQ FA35983D09E4C9CA q55559_syny3 sll0169 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MFIPLDFYRILGIPPQSGGETIEQAYQDRLLQLPRREFSDAAVTLRNQLLAIAYETLRDPEKRQAYDQEWWGAMDEALGEALPLTTPELECSPEQEIGALLILLDLGEYELVVKYGEPVLHDPNPPAGGLPQDYLLSVILAHWELSRERWQQQQYEFAATASLKALARLQQDNDFPALEAEIRQELYRLRPYRILELLAKEGQGEEQRQQGLALLQAMVQDRGGIEGKGEDYSGLGNDDFLKFIHQLRCHLTVAEQNALFLPESQRPSLVASYLAVHSLMAEGVKEQDPMAIVEAKSLIIQLENCQDLALEKVICELLLGQTEVVLAAIDQGDPKIVAGLESKLATGEDPLTAFYTFTEQWLEEEIVPYFRDLSPETLSPKAYFNNPSVQQYLEQLEPDSFTTDNSFASPALLSTATESETPMVHSSAALPDRPLTSTVPSRRGRSPRRSRDDVFPSADNSSGLAVTTLSPAIAYDTHSLGTNGIGGDSTSNGFSSNSAPESTSKHKSPRRRKKRVTIKPVRFGIFLLCLAGIVGGATALIINRTGDPLGGLLEDPLDVFLDQPSEFIPDEATSRNLILSQPNFNQQVGQMVVQGWLDSKKLAFGQNYDVGALQSVLAPNLLAQQRGRAQRDQAQKVYHQYEHKLQILAYQVNPQDPNRATVTARVEEISQPFTLGNQQQKGSATKDDLTVRYQLVRHQGVWKIDQIQVVNGPR 51B52C16F405ED3E p73081_syny3 sll1939 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MTISQAQKDPGILQTVSLLTAYCFDLRGMAPKQVINGWLKNFSALWIRLAVIEALYLGRYKAVSVEHLLEFWHKKGQPNFHFSAEFERLVSENLPRSLAIARDESMEELTKMADQSWQLKVPTAGQEQSLQSPRRRVSPSDPGELEPLPWHHRALGNIQHPNQENLKGSNVSEEGPVTRNPGPAPSIEQFIPITQESNFLSRLQSVLSQDTENV F857C831FF2DBA83 p73117_syny3 ftsI protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MDSSHPKLNSSTANSSPFTKHISRQERHRQKTQQQGVPVVRLLLVWGFLFVAMGGLAYRLYRLQVVEANQLQRMAKAQQSTSMQPYVPRRSIVDSQGNVLATDRLTYTLFVHPRYFEATKEITDPTDYIARELSAILGDITPAQLKEKFKEKESGIKLATGLNESQAVRIGSLRMGGVDLEKQYSRYYPQDEMAADVVGYVDGEHQGQAGLELSQREILEREVETYAIRRTGKGVVLPDSLPDNLLQSNDWQVQLTIDMRLQRAARELLKAQVAQQKAKRGTVLVMDAQDGAILAMVNEPTFNPNEYYKAKVEYFKNWSVSDLYEPGSTFKPVIVALAMNEGVLKPEDRINDSGSVRVGPWTISNASKSGAGMINITQVLRYSSNVAMVAIARRLKPERYYELLQGVGLDSRTGIDLPGEAASYLKPRQSFMDDPIEQATTSFGQGLSLTPIKLLQLNAMLANGGKLVTPHVVKGLVDARNHLHWQPDHPVKQVVKPEVAHSVVQMMESVVSGDGGTGKAALIPGYRVGGKTGTAQKAGPRGGYLANAKITSFVSILPVDNPRYVVVAIIDEPKGANAYGGTVAAPVVKNVMEALIAIKGIPPSQPQ FCE99B0248F0810B q55436_syny3 slr0848 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MTRRESANPEVTENSAVVPGQTVDFDIQQQLAELQELLYDSFHIPLTAWSVVDEEKILDQIDVIAEFIPGAVHRAIAILEREQQILQGAELEAQRMIEVAHQEAQRIKDESGIIQKAQYEADQYKAQVQQDCDALQRQVQQECEALQRQTQQECDTLRRQTMGELEQIKQVTHQEIQQFRQQTVQECEALQKQTEQEATEMQRDVDTYADRLLSRLEGELGQMMRSVSQSRQILYENSAEHNATITNRPPVATPSPVLPPSPGPKPPRGDRPRRRSR B99CA65800EA75A2 p72971_syny3 slr1593 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MFIFPRFPRSLSENGFSQHGTAPPVVPEESNSSSDRKQYIKWALTKAVTEGGFRLDFQPQWDGQGINLVGVEALVRWQDPKLGNVPPAEFIPIAEETGLVTAIGEWVLDTACRQYKIWQAQGVPAFLLGVNLSLQQLQKADFAETVRCILEETNMPAAQLQLEMTEGLIFRDLQHTIGVLRDLQRLGVHLAIDDFGTGYSSLSVLKELPVHTLKIDKSFLEDLETHQKAEVIIESIINLGQRLQLVVVAEGVETEGQLHLLQSLRCDVLQGFFFSCPLSEDKMTHYLHHCCSAKTLSRAIASY 13560E57177FB8DD p73457_syny3 sll1632 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MTDLVVSDSLKNRREQLMWQRRWKRLRSCWQFVCVCGLTGGMVWVMSWPEWSIRSDRQVEFLGNKLVSRETLYEDLDLEYPQAVWQLSTQALGDELAKNPALLRVEVTRQLFPAQVNVAVQERQPVAIAVADQGPGYLDGEGNYIPASLYSQAVRKTLPQTPQFLGYGPQYRSFWQTHQILIQQSPVNIRIINGNNPSNISLTTDLGLVFIGSDLSRFGQQVQVLEKMQNLPSRVPKERLLFIDLTNPDSPSIQLRPQPPKEKAAVNKP 9B06BCE1C21E62C3 q55436-q55436 2 7 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig. 1 q55436-q55559 2 7 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey Q55559:p.Ile139Gln Q55559-127-401 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain I Q Wed May 02 19:25:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile139gln' Tue Jun 30 19:56:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile139Gln' Q55559:p.[Thr252Ala;Glu255_Gln256delinsGlnArg] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain EQ QR certain certain sequence position certain certain certain sequence position certain T A Thu Jul 07 12:16:33 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was thr252ala_glu255gln_gln256arg Fri Jul 22 11:05:41 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'thr252ala,glu255gln,gln256arg' Wed May 02 17:27:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr252ala,glu_gln255-256gln_arg' Tue Jun 30 18:25:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr252Ala;Glu255_Gln256delinsGlnArg]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q55559:p.Asp307Asn mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain D N Wed May 02 17:27:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp307asn' Tue Jun 30 17:57:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp307Asn' physical association physical association Fig. 1 p72971-p72971 2 8 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Fig. 1 p72971-ftsi 2 6 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Fig. 1 p72971-p73457 2 8 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Fig. 1 p72971-q55559 2 4 unspecified role unspecified role prey prey region Q55559-127-401 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait physical association physical association Fig. 1 ftsi-p72971 2 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Fig. 1 ftsi-ftsi-2 2 6 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Fig. 1 ftsi-p73457-1 2 6 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Fig. 1 ftsi-q55559-1 2 6 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey region Q55559-127-401 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 1 p73457-p72971 2 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Fig. 1 p73457-ftsi-1 2 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait physical association physical association Fig. 1 p73457-p73457-1 2 9 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association Fig. 1 p73457-q55559-1 2 9 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey region Q55559-127-401 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q55559:p.[Thr252Ala;Glu255_Gln256delinsGlnArg] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain EQ QR certain certain sequence position certain certain certain sequence position certain T A Thu Jul 07 12:17:47 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was thr252ala_glu255gln_gln256arg Fri Jul 22 10:50:20 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'thr252ala,glu255gln,gln256arg' Wed May 02 17:01:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr252ala,glu_gln255-256gln_arg' Tue Jun 30 16:25:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr252Ala;Glu255_Gln256delinsGlnArg]' Q55559:p.Arg208Gln mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R Q Wed May 02 17:10:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg208gln' Tue Jun 30 19:28:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg208Gln' physical association physical association Fig. 1 p73081-q55559 2 4 unspecified role unspecified role prey prey region Q55559-127-401 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q55559:p.[Thr252Ala;Glu255_Gln256delinsGlnArg] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain EQ QR Thu Jul 07 12:18:04 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was thr252ala_glu255gln_gln256arg Fri Jul 22 11:04:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'thr252ala,glu255gln,gln256arg' Wed May 02 15:44:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr252ala,glu_gln255-256gln_arg' Tue Jun 30 17:06:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr252Ala;Glu255_Gln256delinsGlnArg]' 5 unspecified role unspecified role bait bait physical association physical association Fig. 1 sepf-q55559 2 4 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Q55559:p.Arg147_Glu148delinsGlnGln mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain RE QQ Thu Jul 07 12:18:02 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was arg147_glu148gln Fri Jul 22 11:11:00 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'arg147gln,glu148gln' Wed May 02 15:47:56 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg_glu147-148gln_gln' Tue Jun 30 15:54:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg147_Glu148delinsGlnGln' Q55559:p.[Thr252Ala;Glu255_Gln256delinsGlnArg] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain T A certain certain sequence position certain certain certain sequence position certain EQ QR Thu Jul 07 12:18:00 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was thr252ala_glu255gln_gln256arg Fri Jul 22 10:50:01 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'thr252ala,glu255gln,gln256arg' Wed May 02 18:19:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr252ala,glu_gln255-256gln_arg' Tue Jun 30 19:01:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Thr252Ala;Glu255_Gln256delinsGlnArg]' Q55559:p.Arg190Gln mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R Q Wed May 02 18:23:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg190gln' Tue Jun 30 18:58:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg190Gln' 3 unspecified role unspecified role bait bait physical association physical association Fig. 1, 2 q55559-q55436 2 7 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Fig. 1,2 q55559-p72971 2 8 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Fig. 1 q55559-ftsi-1 2 4 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association Fig. 1 q55559-p73457-1 2 9 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait physical association physical association Fig. 1 q55559-p73081 2 4 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association Fig. 1 q55559-q55559-1 2 4 unspecified role unspecified role prey prey region Q55559-127-401 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 4 unspecified role unspecified role bait bait region Q55559-127-401 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:46:33 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'q55559-127-401' 92 90 physical association physical association Fig. 1 q55559-q55436-1 1 4 unspecified role unspecified role bait bait c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 7 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association Fig. 3 q55559-p73081-1 1 5 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 4 unspecified role unspecified role bait bait c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association Fig. 3 q55559-sepf 1 3 unspecified role unspecified role prey prey c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 4 unspecified role unspecified role bait bait c-terminal ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli physical association physical association Fig. 3