mpidb The Microbial Protein Interaction Database Characterization of the FtsZ-interacting septal proteins SepF and Ftn6 in the spherical-celled cyanobacterium Synechocystis strain PCC 6803. Characterization of the FtsZ-interacting septal proteins SepF and Ftn6 in the spherical-celled cyanobacterium Synechocystis strain PCC 6803. J. Bacteriol. (0021-9193) 2009 imex curation Marbouty M., Saguez C., Cassier-Chauvat C., Chauvat F. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Only protein-protein interactions in vitro In vitro affinity techniques affinity technology affinity techniques tag fluorescence tag visualisation by fluorescence tag fluorescence Marbouty M., Saguez C., Cassier-Chauvat C., Chauvat F. Cyanobacteria - Interaction dataset based on Cyanobacteria proteins and related species Accepted 2013-FEB-13 by ORCHARD J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation sepf_syny3 Cell division protein SepF sepF slr2073 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MILTKLKDFVGISEHDEYEEDYDEEMEFPQSVASQPPAEEVAPPPRISREPLSLNNETSIGTGVRNNVIGMPGINNSVAEVVVVEPHSFDEMPQVIQTLRERKSVVLNLNVMDPEEAQRAVDFVAGGTFAMDGHQERIGESIFLFTPNCVKVSSLAGRSQESNETSSSVSSDNFPTWGYETSRLAQ FA35983D09E4C9CA p73081_syny3 sll1939 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MTISQAQKDPGILQTVSLLTAYCFDLRGMAPKQVINGWLKNFSALWIRLAVIEALYLGRYKAVSVEHLLEFWHKKGQPNFHFSAEFERLVSENLPRSLAIARDESMEELTKMADQSWQLKVPTAGQEQSLQSPRRRVSPSDPGELEPLPWHHRALGNIQHPNQENLKGSNVSEEGPVTRNPGPAPSIEQFIPITQESNFLSRLQSVLSQDTENV F857C831FF2DBA83 ftsz_syny3 Cell division protein FtsZ ftsZ sll1633 protein protein syny3 Synechocystis sp. (strain PCC 6803 / Kazusa) MTLNNDLPLNNIGFTGSGLNDGTEGLDDLFSSSIVDNEPLEALVETPTFASPSPNLKRDQIVPSNIAKIKVIGVGGGGCNAVNRMIASGVTGIDFWAINTDSQALTNTNAPDCIQIGQKLTRGLGAGGNPAIGQKAAEESRDEIARSLEGTDLVFITAGMGGGTGTGAAPIVAEVAKEMGCLTVGIVTRPFTFEGRRRAKQAEEGINALQSRVDTLIVIPNNQLLSVIPAETPLQEAFRVADDILRQGVQGISDIIIIPGLVNVDFADVRAVMADAGSALMGIGVGSGKSRAKEAATAAISSPLLESSIQGAKGVVFNVTGGTDLTLHEVNVAAEIIYEVVDADANIIFGAVIDDRLQGEMRITVIATGFNGEKEKPQAKTSSKPVLSGPPAGVETVPSTTTPEDPLGEIPMAPELDIPDFLQKRRFPRR E3C7DD554983FF44 ftsz-sepf-2 1 4 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli 2 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli physical association physical association Fig 4 ftsz-p73081 1 3 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecolx Escherichia coli 4 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association Fig 4