mpidb The Microbial Protein Interaction Database Protein domains and residues involved in the CheZ/CheAS interaction. Protein domains and residues involved in the CheZ/CheAS interaction. J. Bacteriol. (0021-9193) 2009 imex curation Cantwell B.J., Manson M.D. 04-Feb-2013: Contacted by IntAct-Help. Only protein-protein interactions ecoli Escherichia coli (strain K12) fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Cantwell B.J., Manson M.D. Accepted 2013-JAN-21 by ORCHARD 04-Feb-2013: Contacted by IntAct-Help. J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation p07363-2 Chemotaxis protein CheA short cheA b1888 JW1877 protein protein ecoli Escherichia coli (strain K12) MQEQLDAYKQSQEPDAASFDYICQALRQLALEAKGETPSAVTRLSVVAKSEPQDEQSRSQSPRRIILSRLKAGEVDLLEEELGHLTTLTDVVKGADSLSAILPGDIAEDDITAVLCFVIEADQITFETVEVSPKISTPPVLKLAAEQAPTGRVEREKTTRSNESTSIRVAVEKVDQLINLVGELVITQSMLAQRSSELDPVNHGDLITSMGQLQRNARDLQESVMSIRMMPMEYVFSRYPRLVRDLAGKLGKQVELTLVGSSTELDKSLIERIIDPLTHLVRNSLDHGIELPEKRLAAGKNSVGNLILSAEHQGGNICIEVTDDGAGLNRERILAKAASQGLTVSENMSDDEVAMLIFAPGFSTAEQVTDVSGRGVGMDVVKRNIQKMGGHVEIQSKQGTGTTIRILLPLTLAILDGMSVRVADEVFILPLNAVMESLQPREADLHPLAGGERVLEVRGEYLPIVELWKVFNVAGAKTEATQGIVVILQSGGRRYALLVDQLIGQHQVVVKNLESNYRKVPGISAATILGDGSVALIVDVSALQAINREQRMANTAA 8982A8C04F2AEDBA chez_ecoli Protein phosphatase CheZ cheZ b1881 JW1870 Chemotaxis protein CheZ protein protein ecoli Escherichia coli (strain K12) MMQPSIKPADEHSAGDIIARIGSLTRMLRDSLRELGLDQAIAEAAEAIPDARDRLYYVVQMTAQAAERALNSVEASQPHQDQMEKSAKALTQRWDDWFADPIDLADARELVTDTRQFLADVPAHTSFTNAQLLEIMMAQDFQDLTGQVIKRMMDVIQEIERQLLMVLLENIPEQESRPKRENQSLLNGPQVDTSKAGVVASQDQVDDLLDSLGF DIP protein P0A9H9 original sequence version: 75 42308F5AC0685D27 chez-chea-3 1 3 unspecified role unspecified role bait bait c-terminal gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region P0A9H9-70-133 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 2 unspecified role unspecified role prey prey P07363-2:p.Tyr21Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Y S Wed May 02 19:25:58 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr21ser' Tue Jun 30 19:42:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr21Ser' P07363-2:p.Ile22Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain I A Wed May 02 16:20:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile22ala' Tue Jun 30 20:08:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile22Ala' P07363-2:p.Leu26Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L S Wed May 02 14:28:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu26ser' Tue Jun 30 16:22:21 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu26Ser' P07363-2:p.Ile22Ser mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain I S Wed May 02 16:21:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile22ser' Tue Jun 30 17:57:40 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ile22Ser' P07363-2:p.Leu26Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain L A Wed May 02 16:17:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu26ala' Tue Jun 30 17:10:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu26Ala' colocalization colocalization figure 2