mpidb The Microbial Protein Interaction Database Control of Pseudomonas aeruginosa AlgW protease cleavage of MucA by peptide signals and MucB. Control of Pseudomonas aeruginosa AlgW protease cleavage of MucA by peptide signals and MucB. Mol. Microbiol. (0950-382X) 2009 imex curation Cezairliyan B.O., Sauer R.T. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Cezairliyan B.O., Sauer R.T. Accepted 2013-FEB-08 by ORCHARD Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation Control of Pseudomonas aeruginosa AlgW protease cleavage of MucA by peptide signals and MucB. Control of Pseudomonas aeruginosa AlgW protease cleavage of MucA by peptide signals and MucB. Mol. Microbiol. (0950-382X) 2009 imex curation Cezairliyan B.O., Sauer R.T. Only protein-protein interactions in vitro In vitro protease assay protease assay weight by comassie molecular weight estimation by coomasie staining weight by comassie Cezairliyan B.O., Sauer R.T. Accepted 2013-FEB-08 by ORCHARD Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation Control of Pseudomonas aeruginosa AlgW protease cleavage of MucA by peptide signals and MucB. Control of Pseudomonas aeruginosa AlgW protease cleavage of MucA by peptide signals and MucB. Mol. Microbiol. (0950-382X) 2009 imex curation Cezairliyan B.O., Sauer R.T. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps tag fluorescence tag visualisation by fluorescence tag fluorescence Cezairliyan B.O., Sauer R.T. Accepted 2013-FEB-08 by ORCHARD Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation mucb_pseae Sigma factor AlgU regulatory protein MucB mucB algN PA0764 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MRTTSLLLLLGSLMAVPATQAADASDWLNRLAEADRQNSFQGTFVYERNGSFSTHEIWHRVESDGAVRERLLQLDGARQEVVRVDGRTQCISGGLADQLADAQLWPVRKFDPSQLASWYDLRLVGESRVAGRPAVVLAVTPRDQHRYGFELHLDRDTGLPLKSLLLNEKGQLLERFQFTQLNTGAAPAEDQLQAGAECQVVGPAKADGEKTVAWRSEWLPPGFTLTRSFMRRSPVTPDPVACLTYGDGLARFSVFIEPLHGAMVGDARSQLGPTVVVSKRLQTDDGGQMVTVVGEVPLGTAERVALSIRPEAAAQK DC13C21A7BBB9C2C q9hwz4_pseae PA4033 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MGFRPVSQRLRDINLQALGKFSCLALVLGLESVSHPAGPVQAPSFSQGTASPSFATPLGLDGPARARAEMWNVGLSGAVSVRDELRWVF BFD4EBF98897E7E4 muca_pseae Sigma factor AlgU negative regulatory protein mucA PA0763 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MSREALQETLSAVMDNEADELELRRVLAACGEDAELRSTWSRYQLARSVMHREPTLPKLDIAAAVSAALADEAAPPKAEKGPWRMVGRLAVAASVTLAVLAGVRLYNQNDALPQMAQQGTTPQIALPQVKGPAVLAGYSEEQGAPQVITNSSSSDTRWHEQRLPIYLRQHVQQSAVSGTESALPYARAASLENR 421755F4F113769B q9hvx1_pseae Probable periplasmic serine endoprotease DegP-like algW Protease Do PA4446 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MPKALRFLGWPVLVGVLLALLIIQHNPELVGLPRQEVHVEQAPLLSRLQEGPVSYANAVSRAAPAVANLYTTKMVSKPSHPLFDDPMFRRFFGDNLPQQKRMESSLGSAVIMSAEGYLLTNNHVTAGADQIIVALRDGRETIAQLVGSDPETDLAVLKIDLKNLPAMTLGRSDGIRTGDVCLAIGNPFGVGQTVTMGIISATGRNQLGLNTYEDFIQTDAAINPGNSGGALVDAAGNLIGINTAIFSKSGGSQGIGFAIPTKLALEVMQSIIEHGQVIRGWLGVEVKALTPELAESLGLGETAGIVVAGVYRDGPAARGGLLPGDVILTIDKQEASDGRRSMNQVARTRPGQKISIVVLRNGQKVNLTAEVGLRPPPAPAPQQKQDGGE BC3ED49CC6EFE75F mucb-mucb 1 4 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 4 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 11 14 direct interaction direct interaction Fig. 6C algw-muca 2 6 enzyme target enzyme target substrate substrate neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 7 enzyme enzyme neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli cleavage cleavage reaction cleavage Fig. 1 muca-mucb-1 1 6 unspecified role unspecified role neutral component neutral component periplasmic region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 4 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecolx Escherichia coli 24 27 direct interaction direct interaction Fig. 6C algw-muca-1 2 5 stimulator stimulator unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 7 enzyme enzyme neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 6 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli physical association physical association Fig. 1 muca-mucb-2 3 6 unspecified role unspecified role neutral component neutral component region fluor-5-maleimide fluorescein-5-maleimide label fluor-5-maleimide undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P38107:p.Ser154Cys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain S C Wed May 02 15:54:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser154cys' Tue Jun 30 17:48:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser154Cys' periplasmic region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 4 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction Fig. 6B algw-muca-2 2 7 enzyme enzyme neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecolx Escherichia coli 6 enzyme target enzyme target substrate substrate neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecolx Escherichia coli 4 inhibitor inhibitor unspecified role unspecified role ecolx Escherichia coli cleavage cleavage reaction cleavage Fig. 1