mpidb The Microbial Protein Interaction Database Interactions between Brucella suis VirB8 and its homolog TraJ from the plasmid pSB102 underline the dynamic nature of type IV secretion systems. Interactions between Brucella suis VirB8 and its homolog TraJ from the plasmid pSB102 underline the dynamic nature of type IV secretion systems. J. Bacteriol. (0021-9193) 2009 imex curation Bourg G., Sube R., O'Callaghan D., Patey G. Only protein-protein interactions ecoli Escherichia coli (strain K12) adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Bourg G., Sube R., O'Callaghan D., Patey G. Accepted 2013-FEB-08 by ORCHARD J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation a0a0h3g656_brusu BS1330_II0369 protein protein brusu brusu MAGENAIEAIKPHSRGTRPRRERIEVWVSIDEKKELAERADQAGLSNAAFLRAVGLNLPIGSRADLEAVRQLAKVNGDLGRVAGLLKLWLAEKRGQGARPIDVEAMMMDFRAIQEDMRALMGKISK 982BA013F78CB2C7 virb8_brusu Type IV secretion system protein virB8 BRA0062 BS1330_II0062 virB8 protein protein brusu brusu MFGRKQSPQKSVKNGQGNAPSVYDEALNWEAAHVRLVEKSERRAWKIAGAFGTITVLLGIGIAGMLPLKQHVPYLVRVNAQTGAPDILTSLDEKSVSYDTVMDKYWLSQYVIARETYDWYTLQKDYETVGMLSSPSEGQSYASQFQGDKALDKQYGSNVRTSVTIVSIVPNGKGIGTVRFAKTTKRTNETGDGETTHWIATIGYQYVNPSLMSESARLTNPLGFNVTSYRVDPEMGVVQ DIP protein Q7CEG3 original sequence version: 74 68F44CBCF7018023 virb8-virb8-1 1 3 unspecified role unspecified role bait bait periplasmic region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role prey prey periplasmic region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3 q8fws3-q8fws3 1 2 unspecified role unspecified role prey prey periplasmic region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 2 unspecified role unspecified role bait bait periplasmic region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 3