UniProt UniProt http://www.uniprot.org Kank attenuates actin remodeling by preventing interaction between IRSp53 and Rac1. Kank attenuates actin remodeling by preventing interaction between IRSp53 and Rac1. J. Cell Biol. (0021-9525) 2009 imex curation Roy B.C., Kakinuma N., Kiyama R. kiyama.r@aist.go.jp Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Roy B.C., Kakinuma N., Kiyama R. kiyama.r@aist.go.jp Accepted 2012-JUL-12 by JYOTI human placental cDNA J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation Kank attenuates actin remodeling by preventing interaction between IRSp53 and Rac1. Kank attenuates actin remodeling by preventing interaction between IRSp53 and Rac1. J. Cell Biol. (0021-9525) 2009 imex curation Roy B.C., Kakinuma N., Kiyama R. kiyama.r@aist.go.jp Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Roy B.C., Kakinuma N., Kiyama R. kiyama.r@aist.go.jp Accepted 2012-JUL-12 by JYOTI J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation Kank attenuates actin remodeling by preventing interaction between IRSp53 and Rac1. Kank attenuates actin remodeling by preventing interaction between IRSp53 and Rac1. J. Cell Biol. (0021-9525) 2009 imex curation Roy B.C., Kakinuma N., Kiyama R. kiyama.r@aist.go.jp Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Roy B.C., Kakinuma N., Kiyama R. kiyama.r@aist.go.jp Accepted 2012-JUL-12 by JYOTI J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation Kank attenuates actin remodeling by preventing interaction between IRSp53 and Rac1. Kank attenuates actin remodeling by preventing interaction between IRSp53 and Rac1. J. Cell Biol. (0021-9525) 2009 imex curation Roy B.C., Kakinuma N., Kiyama R. kiyama.r@aist.go.jp Only protein-protein interactions human-vmrc-rcw Homo sapiens renal cell carcinoma cell line VMRC-RCW vmrc-rcw human renal cell carcinoma cell line VMRC-RCW confocal microscopy confocal microscopy immunostaining immunostaining Roy B.C., Kakinuma N., Kiyama R. kiyama.r@aist.go.jp Accepted 2012-JUL-12 by JYOTI J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation Kank attenuates actin remodeling by preventing interaction between IRSp53 and Rac1. Kank attenuates actin remodeling by preventing interaction between IRSp53 and Rac1. J. Cell Biol. (0021-9525) 2009 imex curation Roy B.C., Kakinuma N., Kiyama R. kiyama.r@aist.go.jp Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Roy B.C., Kakinuma N., Kiyama R. kiyama.r@aist.go.jp Accepted 2012-JUL-12 by JYOTI J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation Kank attenuates actin remodeling by preventing interaction between IRSp53 and Rac1. Kank attenuates actin remodeling by preventing interaction between IRSp53 and Rac1. J. Cell Biol. (0021-9525) 2009 imex curation Roy B.C., Kakinuma N., Kiyama R. kiyama.r@aist.go.jp Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Roy B.C., Kakinuma N., Kiyama R. kiyama.r@aist.go.jp Accepted 2012-JUL-12 by JYOTI J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation Kank attenuates actin remodeling by preventing interaction between IRSp53 and Rac1. Kank attenuates actin remodeling by preventing interaction between IRSp53 and Rac1. J. Cell Biol. (0021-9525) 2009 imex curation Roy B.C., Kakinuma N., Kiyama R. kiyama.r@aist.go.jp Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Roy B.C., Kakinuma N., Kiyama R. kiyama.r@aist.go.jp Accepted 2012-JUL-12 by JYOTI J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation Kank attenuates actin remodeling by preventing interaction between IRSp53 and Rac1. Kank attenuates actin remodeling by preventing interaction between IRSp53 and Rac1. J. Cell Biol. (0021-9525) 2009 imex curation Roy B.C., Kakinuma N., Kiyama R. kiyama.r@aist.go.jp Only protein-protein interactions human-vmrc-rcw Homo sapiens renal cell carcinoma cell line VMRC-RCW vmrc-rcw human renal cell carcinoma cell line VMRC-RCW anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Roy B.C., Kakinuma N., Kiyama R. kiyama.r@aist.go.jp Accepted 2012-JUL-12 by JYOTI J. Cell Biol. (0021-9525) 2009 Only protein-protein interactions imex curation wasf2_human Wiskott-Aldrich syndrome protein family member 2 WASF2 WAVE2 Protein WAVE-2 Verprolin homology domain-containing protein 2 protein protein human Homo sapiens Human MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANTFASRVSSLAERVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDTPPPLNNLTPYRDDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKEKLGTSGYPPTLVYQNGSIGCVENVDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDNQRGSGLAGPKRSSVVSPSHPPPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPLSDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSEDDSSEFDEDDWSD DIP protein Q9Y6W5 original sequence version: 93 DIP protein Q9Y6W5 original sequence version: 121 DIP protein Q9Y6W5 original sequence version: 137 C737CE963016DE94 kank1_human KN motif and ankyrin repeat domain-containing protein 1 ANKRD15 KANK KIAA0172 Ankyrin repeat domain-containing protein 15 Kidney ankyrin repeat-containing protein KANK1 protein protein human Homo sapiens Human MAHTTKVNGSASGKAGDILSGDQDKEQKDPYFVETPYGYQLDLDFLKYVDDIQKGNTIKRLNIQKRRKPSVPCPEPRTTSGQQGIWTSTESLSSSNSDDNKQCPNFLIARSQVTSTPISKPPPPLETSLPFLTIPENRQLPPPSPQLPKHNLHVTKTLMETRRRLEQERATMQMTPGEFRRPRLASFGGMGTTSSLPSFVGSGNHNPAKHQLQNGYQGNGDYGSYAPAAPTTSSMGSSIRHSPLSSGISTPVTNVSPMHLQHIREQMAIALKRLKELEEQVRTIPVLQVKISVLQEEKRQLVSQLKNQRAASQINVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIELQQQTIESLKEKIYRLEVQLRETTHDREMTKLKQELQAAGSRKKVDKATMAQPLVFSKVVEAVVQTRDQMVGSHMDLVDTCVGTSVETNSVGISCQPECKNKVVGPELPMNWWIVKERVEMHDRCAGRSVEMCDKSVSVEVSVCETGSNTEESVNDLTLLKTNLNLKEVRSIGCGDCSVDVTVCSPKECASRGVNTEAVSQVEAAVMAVPRTADQDTSTDLEQVHQFTNTETATLIESCTNTCLSTLDKQTSTQTVETRTVAVGEGRVKDINSSTKTRSIGVGTLLSGHSGFDRPSAVKTKESGVGQININDNYLVGLKMRTIACGPPQLTVGLTASRRSVGVGDDPVGESLENPQPQAPLGMMTGLDHYIERIQKLLAEQQTLLAENYSELAEAFGEPHSQMGSLNSQLISTLSSINSVMKSASTEELRNPDFQKTSLGKITGNYLGYTCKCGGLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDDQIAAGLYACTNNESTLKSIMKKKDGNKDSNGAKKNLQFVGINGGYETTSSDDSSSDESSSSESDDECDVIEYPLEEEEEEEDEDTRGMAEGHHAVNIEGLKSARVEDEMQVQECEPEKVEIRERYELSEKMLSACNLLKNTINDPKALTSKDMRFCLNTLQHEWFRVSSQKSAIPAMVGDYIAAFEAISPDVLRYVINLADGNGNTALHYSVSHSNFEIVKLLLDADVCNVDHQNKAGYTPIMLAALAAVEAEKDMRIVEELFGCGDVNAKASQAGQTALMLAVSHGRIDMVKGLLACGADVNIQDDEGSTALMCASEHGHVEIVKLLLAQPGCNGHLEDNDGSTALSIALEAGHKDIAVLLYAHVNFAKAQSPGTPRLGRKTSPGPTHRGSFD DIP protein Q14678 original sequence version: 100 0C3993143391363B q14678-1 KN motif and ankyrin repeat domain-containing protein 1 Kank-L KANK1 ANKRD15 KANK KIAA0172 Ankyrin repeat domain-containing protein 15 Kidney ankyrin repeat-containing protein protein protein human Homo sapiens Human MAHTTKVNGSASGKAGDILSGDQDKEQKDPYFVETPYGYQLDLDFLKYVDDIQKGNTIKRLNIQKRRKPSVPCPEPRTTSGQQGIWTSTESLSSSNSDDNKQCPNFLIARSQVTSTPISKPPPPLETSLPFLTIPENRQLPPPSPQLPKHNLHVTKTLMETRRRLEQERATMQMTPGEFRRPRLASFGGMGTTSSLPSFVGSGNHNPAKHQLQNGYQGNGDYGSYAPAAPTTSSMGSSIRHSPLSSGISTPVTNVSPMHLQHIREQMAIALKRLKELEEQVRTIPVLQVKISVLQEEKRQLVSQLKNQRAASQINVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIELQQQTIESLKEKIYRLEVQLRETTHDREMTKLKQELQAAGSRKKVDKATMAQPLVFSKVVEAVVQTRDQMVGSHMDLVDTCVGTSVETNSVGISCQPECKNKVVGPELPMNWWIVKERVEMHDRCAGRSVEMCDKSVSVEVSVCETGSNTEESVNDLTLLKTNLNLKEVRSIGCGDCSVDVTVCSPKECASRGVNTEAVSQVEAAVMAVPRTADQDTSTDLEQVHQFTNTETATLIESCTNTCLSTLDKQTSTQTVETRTVAVGEGRVKDINSSTKTRSIGVGTLLSGHSGFDRPSAVKTKESGVGQININDNYLVGLKMRTIACGPPQLTVGLTASRRSVGVGDDPVGESLENPQPQAPLGMMTGLDHYIERIQKLLAEQQTLLAENYSELAEAFGEPHSQMGSLNSQLISTLSSINSVMKSASTEELRNPDFQKTSLGKITGNYLGYTCKCGGLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDDQIAAGLYACTNNESTLKSIMKKKDGNKDSNGAKKNLQFVGINGGYETTSSDDSSSDESSSSESDDECDVIEYPLEEEEEEEDEDTRGMAEGHHAVNIEGLKSARVEDEMQVQECEPEKVEIRERYELSEKMLSACNLLKNTINDPKALTSKDMRFCLNTLQHEWFRVSSQKSAIPAMVGDYIAAFEAISPDVLRYVINLADGNGNTALHYSVSHSNFEIVKLLLDADVCNVDHQNKAGYTPIMLAALAAVEAEKDMRIVEELFGCGDVNAKASQAGQTALMLAVSHGRIDMVKGLLACGADVNIQDDEGSTALMCASEHGHVEIVKLLLAQPGCNGHLEDNDGSTALSIALEAGHKDIAVLLYAHVNFAKAQSPGTPRLGRKTSPGPTHRGSFD 0C3993143391363B q9uqb8-4 Brain-specific angiogenesis inhibitor 1-associated protein 2 BAIAP2-alpha BAIAP2 Fas ligand-associated factor 3 Insulin receptor substrate p53/p58 Insulin receptor substrate protein of 53 kDa protein protein human Homo sapiens Human MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSSGSGTLVSTV DIP protein Q9UQB8-4 original sequence version: 97 DIP protein Q9UQB8-4 original sequence version: 125 618A09FDBEB3A5C3 rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL ACEDF83A45E5EA67 baip2_human Brain-specific angiogenesis inhibitor 1-associated protein 2 Insulin receptor substrate protein of 53 kDa Insulin receptor substrate p53/p58 Fas ligand-associated factor 3 BAIAP2 protein protein human Homo sapiens Human MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSKELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAAYHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVPPELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPKNSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEKTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRPYSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR DIP protein Q9UQB8 original sequence version: 87 3B9EDC6405DCC99D actb_human Actin, cytoplasmic 1 ACTB Beta-actin protein protein human Homo sapiens Human MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF DIP protein P60709 original sequence version: null DIP protein P60709 original sequence version: 63 DIP protein P60709 original sequence version: 128 DIP protein P60709 original sequence version: 129 DIP protein P60709 original sequence version: 58 DIP protein P60709 original sequence version: 66 DIP protein P60709 original sequence version: 88 DIP protein P60709 original sequence version: 89 DIP protein P60709 original sequence version: 86 DIP protein P60709 original sequence version: 138 DIP protein P60709 original sequence version: 112 6AFD05CA94E360E2 cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL 51A437E22A4D8FFF q14678-2 KN motif and ankyrin repeat domain-containing protein 1 Kank-S KANK1 ANKRD15 KANK KIAA0172 Ankyrin repeat domain-containing protein 15 Kidney ankyrin repeat-containing protein protein protein human Homo sapiens Human METRRRLEQERATMQMTPGEFRRPRLASFGGMGTTSSLPSFVGSGNHNPAKHQLQNGYQGNGDYGSYAPAAPTTSSMGSSIRHSPLSSGISTPVTNVSPMHLQHIREQMAIALKRLKELEEQVRTIPVLQVKISVLQEEKRQLVSQLKNQRAASQINVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQSTQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSRSCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIELQQQTIESLKEKIYRLEVQLRETTHDREMTKLKQELQAAGSRKKVDKATMAQPLVFSKVVEAVVQTRDQMVGSHMDLVDTCVGTSVETNSVGISCQPECKNKVVGPELPMNWWIVKERVEMHDRCAGRSVEMCDKSVSVEVSVCETGSNTEESVNDLTLLKTNLNLKEVRSIGCGDCSVDVTVCSPKECASRGVNTEAVSQVEAAVMAVPRTADQDTSTDLEQVHQFTNTETATLIESCTNTCLSTLDKQTSTQTVETRTVAVGEGRVKDINSSTKTRSIGVGTLLSGHSGFDRPSAVKTKESGVGQININDNYLVGLKMRTIACGPPQLTVGLTASRRSVGVGDDPVGESLENPQPQAPLGMMTGLDHYIERIQKLLAEQQTLLAENYSELAEAFGEPHSQMGSLNSQLISTLSSINSVMKSASTEELRNPDFQKTSLGKITGNYLGYTCKCGGLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDDQIAAGLYACTNNESTLKSIMKKKDGNKDSNGAKKNLQFVGINGGYETTSSDDSSSDESSSSESDDECDVIEYPLEEEEEEEDEDTRGMAEGHHAVNIEGLKSARVEDEMQVQECEPEKVEIRERYELSEKMLSACNLLKNTINDPKALTSKDMRFCLNTLQHEWFRVSSQKSAIPAMVGDYIAAFEAISPDVLRYVINLADGNGNTALHYSVSHSNFEIVKLLLDADVCNVDHQNKAGYTPIMLAALAAVEAEKDMRIVEELFGCGDVNAKASQAGQTALMLAVSHGRIDMVKGLLACGADVNIQDDEGSTALMCASEHGHVEIVKLLLAQPGCNGHLEDNDGSTALSIALEAGHKDIAVLLYAHVNFAKAQSPGTPRLGRKTSPGPTHRGSFD F7CB58D947CCCE4C kank1-baiap2 8 10 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association 1A baiap2-kank1-1 8 17 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey association association 1A baiap2-kank1-2 4 10 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component physical association physical association 1B kank1-baiap2-1 3 17 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terninus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain physical association physical association 2B baiap2-kank1-3 3 17 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection n-terninus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 2D kank1-baiap2-2 3 17 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 42 46 physical association physical association 2E baiap2-kank1-4 3 12 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range 17 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 2E baiap2-rac1 2 13 unspecified role unspecified role unspecified role unspecified role purified purified region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P63000:p.Gly12Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 18:06:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val' Tue Jun 30 16:20:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' constitutive active Rac1 ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role unspecified role unspecified role Q9UQB8-4:p.[Arg11Glu;Lys143Glu] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R E certain certain sequence position certain certain certain sequence position certain K E Wed May 02 19:53:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg11glu,lys143glu' Tue Jun 30 19:27:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Arg11Glu;Lys143Glu]' n-etrminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) physical association physical association 3A and S1 KANK1 (AC Q14678) coiled coil region cdc42-baiap2-1 2 16 unspecified role unspecified role prey prey purified purified P60953:p.Gly12Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 15:56:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val' Tue Jun 30 20:06:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' constitutive active CDC42 region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-etrminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) physical association physical association 3A KANK1 (AC Q14678) coiled coil region kank1-wasf2 4 9 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component physical association physical association 1C kank1-baiap2-3 1 10 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association no figure kank1-baiap2-4 6 10 unspecified role unspecified role bait bait 14 unspecified role unspecified role prey prey physical association physical association no figure baiap2-kank1-6 5 14 unspecified role unspecified role bait bait 10 competitor competitor competitor prey prey 13 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection P63000:p.Gly12Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 17:45:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val' Tue Jun 30 20:09:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' constitutive active Rac1 association association 3C baiap2-kank1-7 7 14 unspecified role unspecified role unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role unspecified role unspecified role region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 89 85 physical association physical association S1 baiap2-actb 5 15 unspecified role unspecified role prey prey 14 unspecified role unspecified role bait bait physical association physical association S5 KANK1 (AC Q14678)